RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780805|ref|YP_003065218.1| chromosome partitioning protein B [Candidatus Liberibacter asiaticus str. psy62] (300 letters) >gnl|CDD|31664 COG1475, Spo0J, Predicted transcriptional regulators [Transcription]. Length = 240 Score = 139 bits (351), Expect = 7e-34 Identities = 83/221 (37%), Positives = 132/221 (59%), Gaps = 8/221 (3%) Query: 42 ISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAA 101 I I I PNP PR F+ E LE+L SIK G+IQP++VR Y+I+ G RR RAA Sbjct: 7 IDIVLIAPNPLQPRKKFDEESLEELAASIKEFGLIQPIVVRP----RYEIVDGHRRLRAA 62 Query: 102 KMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALG-YEQLISEYGYTQNDIGS 160 K+ L EVPVI+R+++++ LE+++ EN+QR+DL P+EEALG Y +LI +G T+ I Sbjct: 63 KLLGLEEVPVIVRDLEDEKLLELSLAENIQREDLVPIEEALGAYYELIDGFGLTRERIAK 122 Query: 161 IVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDP---LSLAQVIVSKKM 217 +GKSR+ ++N+L + LP V E + + +++ HAR L+S + + +V + + Sbjct: 123 ALGKSRARISNLLPLAALPEEVVEALGRIALTIRHARALLSLLVEELMSEIVRELVKEGL 182 Query: 218 SVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKIS 258 SVR E+LV+ + + + + + K ++ L I Sbjct: 183 SVRWIEKLVRALIKDALEELGMDKDEKLRLKQISGLAVLIK 223 >gnl|CDD|145381 pfam02195, ParBc, ParB-like nuclease domain. Length = 90 Score = 92.8 bits (231), Expect = 1e-19 Identities = 40/89 (44%), Positives = 58/89 (65%), Gaps = 1/89 (1%) Query: 42 ISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAA 101 + I + PN PR E E LE+L SIK HG++QP+IVR G Y+II G RR RAA Sbjct: 3 VPIDKLRPNEDQPRLTSEEE-LEELIASIKEHGLLQPIIVRKTPGGRYEIIDGHRRLRAA 61 Query: 102 KMASLSEVPVIIRNVDNKSSLEIAIVENV 130 K+ L EVPVI+ +D++ ++ +++ EN+ Sbjct: 62 KLLGLKEVPVIVLELDDEEAIALSLEENI 90 >gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]. Length = 782 Score = 34.4 bits (79), Expect = 0.037 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 23/198 (11%) Query: 102 KMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEAL--GYEQLISEYGYTQNDIG 159 ++ +L+++ I++ D + + ++ V+ L+ EE E L E + +I Sbjct: 70 EVGTLAKILQILKLPDGTVKVLVEGLQRVRISKLSDEEEFFEAEIELLPDEPIDEEREIE 129 Query: 160 SIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSV 219 ++V S ++ K I EE+ ++L S DP LA I + Sbjct: 130 ALVRSILSEFEEYAKLNKK-------IPPEEL-----QSLNSIDDPGKLADTIAAHLPLK 177 Query: 220 RDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIK 279 + ++ + E + KE+ +K+ EKE L LEK+I KV + R Sbjct: 178 LEEKQEILETLDVKERLEKLL-DLLEKEIDLLQLEKRIRKKVKEQMEKSQRE-------- 228 Query: 280 YETNEQLKIICSLLGEND 297 Y EQLK I LGE+D Sbjct: 229 YYLREQLKAIQKELGEDD 246 >gnl|CDD|31849 COG1663, LpxK, Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]. Length = 336 Score = 29.9 bits (67), Expect = 0.82 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 9/57 (15%) Query: 88 LYKIIAGERRFRAAKMASLSEVPVIIRNVDN-------KSSLEIAIVENVQRKDLNP 137 LY IAG RR A K + + VPVI V N K+ + I + E +Q + + Sbjct: 26 LYAFIAGLRRKLAKKGSYRAPVPVIC--VGNLTVGGTGKTPVVIWLAEALQARGVRV 80 >gnl|CDD|30057 cd01314, D-HYD, D-hydantoinases (D-HYD) also called dihydropyrimidases (DHPase) and related proteins; DHPases are a family of enzymes that catalyze the reversible hydrolytic ring opening of the amide bond in five- or six-membered cyclic diamides, like dihydropyrimidine or hydantoin. The hydrolysis of dihydropyrimidines is the second step of reductive catabolism of pyrimidines in human. The hydrolysis of 5-substituted hydantoins in microorganisms leads to enantiomerically pure N-carbamyl amino acids, which are used for the production of antibiotics, peptide hormones, pyrethroids, and pesticides. HYDs are classified depending on their stereoselectivity. This family also includes collapsin response regulators (CRMPs), cytosolic proteins involved in neuronal differentiation and axonal guidance which have strong homology to DHPases, but lack most of the active site residues.. Length = 447 Score = 29.0 bits (65), Expect = 1.5 Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 7/65 (10%) Query: 63 LEDLCQSIKSHGIIQPLIVRAIDNGLYK--IIAGERRFRAAKMASLSEVPVIIRNVDNKS 120 + +L + + + G P + L + + E RA ++A L+ P+ I +V +K Sbjct: 188 IAELQKKLLAQGKTGP-----EYHALSRPPEVEAEATARAIRLAELAGAPLYIVHVSSKE 242 Query: 121 SLEIA 125 + + Sbjct: 243 AADEI 247 >gnl|CDD|37394 KOG2183, KOG2183, KOG2183, Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones, General function prediction only]. Length = 492 Score = 28.7 bits (64), Expect = 2.2 Identities = 9/41 (21%), Positives = 15/41 (36%) Query: 38 SQDCISIHSIVPNPHNPRNYFESEGLEDLCQSIKSHGIIQP 78 + C+ + P P F L I S+G++ P Sbjct: 387 QEGCMQTFGVTPRPKWITTEFGGADLSAFSNIIFSNGLLDP 427 >gnl|CDD|34166 COG4499, COG4499, Predicted membrane protein [Function unknown]. Length = 434 Score = 28.4 bits (63), Expect = 2.7 Identities = 13/68 (19%), Positives = 20/68 (29%) Query: 220 RDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIK 279 E + + E F +E K L ++ K I + + F I Sbjct: 7 PYMEMQNSKTSLEFEDAAYTFTFPKESIKLKEALLAELLDKSPPFIVAEITEDNDSFVIS 66 Query: 280 YETNEQLK 287 Y E K Sbjct: 67 YPIPEAAK 74 >gnl|CDD|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.. Length = 355 Score = 27.6 bits (62), Expect = 4.4 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 171 NILRILKLPSSVREMIRKEEISLGHAR 197 N LRIL + +R +IR+E++ + HAR Sbjct: 59 NPLRILLNVARLRRLIREEKVDIVHAR 85 >gnl|CDD|39358 KOG4156, KOG4156, KOG4156, Claspin, protein mediating phosphorylation and activation of Chk1 protein kinase in the DNA replication checkpoint response [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms]. Length = 1329 Score = 27.6 bits (60), Expect = 4.8 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query: 200 VSTSDPLSLAQVIVSK---KMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKK 256 S + P QV+ +K M +R EE + Q K + E E+E+ +TD ++ Sbjct: 585 ASHTKPGEKLQVLKAKLQEAMKLRRFEERQKRQALFKLDNEDGKEEEEEEEEEMTDESEE 644 >gnl|CDD|37783 KOG2572, KOG2572, KOG2572, Ribosome biogenesis protein - Nop58p/Nop5p [RNA processing and modification, Translation, ribosomal structure and biogenesis]. Length = 498 Score = 26.9 bits (59), Expect = 6.8 Identities = 22/125 (17%), Positives = 48/125 (38%), Gaps = 9/125 (7%) Query: 153 YTQNDIGSIVGKSRSHVANILRIL------KLPSSVREMIRKEEISLGHARTLVSTSDPL 206 + I ++R+ + LR L + + + +KE+ T T + + Sbjct: 373 LGEESTNEIGVENRAKLEKRLRSLEGRDLQESSILKKPLAKKEKYEGRSETTSADTYNTI 432 Query: 207 SLAQVIV---SKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGL 263 + SK+ + ++L + ++ + K+K+ E +K K EKK + K Sbjct: 433 RDSARDKEEGSKEKKKKKAKKLGEGEEEESSKKKEKKEKKAKKAKKPAKEEKKPAKKKKK 492 Query: 264 NISIK 268 + K Sbjct: 493 SKKKK 497 >gnl|CDD|146157 pfam03370, CBM_21, Putative phosphatase regulatory subunit. This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain. Length = 108 Score = 26.8 bits (60), Expect = 7.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 275 QFCIKYETNEQ 285 +FCI+YE N Q Sbjct: 85 EFCIRYEVNGQ 95 >gnl|CDD|176947 CHL00002, matK, maturase K. Length = 504 Score = 26.8 bits (60), Expect = 7.8 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query: 23 QSIDSPEKKTETIPESQDCISIHSIVP 49 + + S E+K I +SQ+ SIHSI P Sbjct: 109 RLVSSLEEKE--IAKSQNLRSIHSIFP 133 >gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]. Length = 906 Score = 26.8 bits (59), Expect = 7.8 Identities = 44/207 (21%), Positives = 71/207 (34%), Gaps = 49/207 (23%) Query: 92 IAGERRFRAAKMASLSEVPVIIRNVDNKSSLEIAIVENVQRKDLNPLEEALGYEQLISEY 151 + G R +M E V+ V+N P ++ + L SE Sbjct: 175 VTGLSRLNITEMKEEKEAEVLSVEVENVK--------------DEPFKKDEEIKALTSEI 220 Query: 152 GYTQNDIGSIVGKSRSHVANILRILKLPSSVREMIRKEEISLGHARTLVSTSDPLSLAQV 211 T DI ++ R VA + + L+ +P+ LA Sbjct: 221 LKTLRDIIAVNSLFREQVATLSQ------------------------LIVEDNPIKLADF 256 Query: 212 IVS-KKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVGLNISIKHR 270 + + +E+++E D +K K + +E E L L++KI +V I HR Sbjct: 257 GAAISGAEFHELQEVLEETDIEKRLEKALELLKKELE--LAKLQQKIGKEVEEKIKQDHR 314 Query: 271 NNKGQFCIKYETNEQLKIICSLLGEND 297 +Y EQLK I LG Sbjct: 315 --------EYLLREQLKAIKKELGIEK 333 >gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP). This family consists of several eukaryotic kinesin-associated (KAP) proteins. Kinesins are intracellular multimeric transport motor proteins that move cellular cargo on microtubule tracks. It has been shown that the sea urchin KRP85/95 holoenzyme associates with a KAP115 non-motor protein, forming a heterotrimeric complex in vitro, called the Kinesin-II. Length = 708 Score = 26.7 bits (59), Expect = 8.7 Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 9/67 (13%) Query: 187 RKEEISLGHARTLVSTSDPLSLAQVIVSK-----KMSVRDTEELVQEQDNKKEKRKKIFE 241 RKE + ++L + +D +LA+ +V K + + E+L+ N+K+ R Sbjct: 37 RKECQKIIRLKSLNADTDIAALAREVVEKCKLIHPSKLNEVEQLLFYLQNRKDSRS---- 92 Query: 242 GSREKEK 248 +R + Sbjct: 93 SARSRSS 99 >gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus. Length = 249 Score = 26.4 bits (59), Expect = 9.6 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 13/67 (19%) Query: 203 SDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIFEGSREKEKYLTDLEKKISSKVG 262 S P L ++IV S T E+VQE K + + L D K+I S G Sbjct: 26 SYPKDLIEIIVVDGGSTDGTREIVQEYAAKDPRIR------------LIDNPKRIQSA-G 72 Query: 263 LNISIKH 269 LNI I++ Sbjct: 73 LNIGIRN 79 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.313 0.132 0.356 Gapped Lambda K H 0.267 0.0615 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,370,976 Number of extensions: 171957 Number of successful extensions: 441 Number of sequences better than 10.0: 1 Number of HSP's gapped: 433 Number of HSP's successfully gapped: 46 Length of query: 300 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 207 Effective length of database: 4,254,100 Effective search space: 880598700 Effective search space used: 880598700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 57 (26.0 bits)