HHsearch alignment for GI: 254780806 and conserved domain: CHL00072

>CHL00072 chlL photochlorophyllide reductase subunit L.
Probab=100.00  E-value=1.8e-34  Score=220.81  Aligned_cols=235  Identities=21%  Similarity=0.200  Sum_probs=176.1

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCC------CHHHCCCCC
Q ss_conf             99998088988889999999999998799599998787768011212463334541167630257------712102444
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEK------NINQILIQT   81 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~------~l~~~i~~~   81 (265)
T Consensus         2 ~iaiy-GKGGIGKSTtsaNlsaaLA~~GkkVl~IGcDpk~DsT~~L~g---~~~~tvld~l~~~~~~~~~~~~edvi~-~   76 (271)
T CHL00072          2 KIAVY-GKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTG---FLIPTIIDTLQSKDYHYEDVWPEDVIY-K   76 (271)
T ss_pred             EEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHCC---CCCCCHHHHHHHHCCCCCCCCHHHHHH-C
T ss_conf             69997-898544858899999999987997999789973777740069---988859999975378732164999985-2


Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCC-CCCCHHHHHHHCCCCCCCCCHHH
Q ss_conf             44420001488745775000123222210233322476510278203310133322-22101123310011111231137
Q gi|254780806|r   82 AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNL-LTMNAMAAADSILVPLQCEFFAL  160 (265)
Q Consensus        82 ~~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~-~~~~al~aad~viip~~p~~~s~  160 (265)
T Consensus        77 G~~gi~cvEaGGPepGvGCaGrgi~~~i~lL~~-l~--~~~d~D~V~yDvlgDVVCGGFa~Pi~~Ad~~~iVts~e~mal  153 (271)
T CHL00072         77 GYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKE-LN--AFYEYDVILFDVLGDVVCGGFAAPLNYADYCIIITDNGFDAL  153 (271)
T ss_pred             CCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHH-CC--CCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCHHHH
T ss_conf             778846654389998877788651999999997-37--621388899944776556545675000888999956708899


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCEEEECCC
Q ss_conf             88875335777655432026774310020231253100112689998808520156267868898777379857999799
Q gi|254780806|r  161 EGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK  240 (265)
Q Consensus       161 ~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~~~Ip~~~~i~~a~~~g~pv~~~~p~  240 (265)
T Consensus       154 yaANnI~~~i~~~a~~~~--~rl~GiI~N~~~-----~~~~v~~fa~~~g~~~i~-~iPrd~~V~~ae~~~~TviE~~p~  225 (271)
T CHL00072        154 FAANRIAASVREKARTHP--LRLAGLVGNRTS-----KRDLIDKYVEACPMPVLE-VLPLIEDIRVSRVKGKTLFEMAES  225 (271)
T ss_pred             HHHHHHHHHHHHHHHCCC--CCCCEEEECCCC-----CHHHHHHHHHHCCCCEEE-ECCCCCHHHHHHHCCCCEEECCCC
T ss_conf             999999999999730468--644436522688-----378999999973996698-568711668999748820422899


Q ss_pred             CHH----HHHHHHHHHHHHHHH
Q ss_conf             989----999999999999999
Q gi|254780806|r  241 CAG----SQAYLKLASELIQQE  258 (265)
Q Consensus       241 s~~----a~~~~~la~el~~~~  258 (265)
T Consensus       226 s~~~~~~~~~Yr~LA~~I~~n~  247 (271)
T CHL00072        226 EPSLNYVCDFYLNIADQLLSQP  247 (271)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCC
T ss_conf             8247899999999999997399