HHsearch alignment for GI: 254780806 and conserved domain: COG0480

>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis].
Probab=96.78  E-value=0.002  Score=39.55  Aligned_cols=84  Identities=12%  Similarity=0.167  Sum_probs=53.8

Q ss_pred             CCCCCEEEECCCCC--CCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHH
Q ss_conf             27820331013332--2221011233100111112311378887533577765543202677431002023125310011
Q gi|254780806|r  123 DFSYIFLDCPPSFN--LLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQ  200 (265)
Q Consensus       123 ~yD~IiiD~pp~~~--~~~~~al~aad~viip~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~  200 (265)
T Consensus        75 ~~~iNlIDTPGHVDFt~EV~rslrvlDgavvVvdaveGV~~QTEtv---~rqa~~---~~vp~i-~fiNKmDR~~a~~~~  147 (697)
T COG0480          75 DYRINLIDTPGHVDFTIEVERSLRVLDGAVVVVDAVEGVEPQTETV---WRQADK---YGVPRI-LFVNKMDRLGADFYL  147 (697)
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHCCEEEEEECCCCEEECHHHH---HHHHHH---CCCCEE-EEEECCCCCCCCHHH
T ss_conf             6589995799735347787998886165099998878830037999---999865---599759-999784335567335


Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             2689998808520
Q gi|254780806|r  201 VVSDVRKNLGGKV  213 (265)
Q Consensus       201 ~~~~l~~~~~~~v  213 (265)
T Consensus       148 ~~~~l~~~l~~~~  160 (697)
T COG0480         148 VVEQLKERLGANP  160 (697)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             0999999867983