HHsearch alignment for GI: 254780806 and conserved domain: KOG1532

>KOG1532 consensus.
Probab=98.14  E-value=5.6e-06  Score=54.38  Aligned_cols=115  Identities=26%  Similarity=0.389  Sum_probs=64.3

Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCC-
Q ss_conf             874999980889888899999999999987995999987877-680112124633345411676302577121024444-
Q gi|254780806|r    5 KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQ-GNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTA-   82 (265)
Q Consensus         5 ~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q-~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~-   82 (265)
T Consensus        18 ~p~~ilVv-GMAGSGKTTF~QrL~~hl~~~~~ppYviNLDPAv~~vpy~aniD-------IRDtV----kYkEvMkqY~L   85 (366)
T KOG1532          18 RPVIILVV-GMAGSGKTTFMQRLNSHLHAKKTPPYVINLDPAVRNVPYPANID-------IRDTV----KYKEVMKQYQL   85 (366)
T ss_pred             CCCEEEEE-ECCCCCCHHHHHHHHHHHHHCCCCCEEEECCHHHHCCCCCCCCC-------HHHHH----HHHHHHHHHCC
T ss_conf             87079999-44778841399999999862369980886788885488866775-------66543----09999998388


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCH
Q ss_conf             442000148874577500012322221023332247651027820331013332222101
Q gi|254780806|r   83 IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNA  142 (265)
Q Consensus        83 ~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~a  142 (265)
T Consensus        86 GPNGgI~Ts---L----NLF~tk~dq---v~~~i-ek~~~~~~~~liDTPGQIE~FtWSA  134 (366)
T KOG1532          86 GPNGGIVTS---L----NLFATKFDQ---VIELI-EKRAEEFDYVLIDTPGQIEAFTWSA  134 (366)
T ss_pred             CCCCCHHHH---H----HHHHHHHHH---HHHHH-HHHHCCCCEEEECCCCCEEEEEECC
T ss_conf             998640335---8----999987899---99999-9742204779974888068998427