HHsearch alignment for GI: 254780806 and conserved domain: PRK05537

>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated.
Probab=96.35  E-value=0.0043  Score=37.52  Aligned_cols=58  Identities=31%  Similarity=0.377  Sum_probs=38.8

Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCC-CCCCHHHCCCCCCCC
Q ss_conf             76874999980889888899999999999987-995999987877-680112124633345
Q gi|254780806|r    3 EKKSRIITIANQKGGVGKTTTAINLSTALAAI-GENVLLIDLDPQ-GNASTGLGIELYDRK   61 (265)
Q Consensus         3 ~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~-g~rVllID~D~q-~~~~~~l~~~~~~~~   61 (265)
T Consensus       389 ~~~G~tiwlT-GLsgsGKsTiA~al~~~L~~~~~~~v~lLDGD~~R~~l~~dLgfs~~dR~  448 (568)
T PRK05537        389 HKQGFTVFFT-GLSGAGKSTIAKALMAKLMEMRGRPVTLLDGDVVRKHLSSELGFSKEDRD  448 (568)
T ss_pred             CCCCEEEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHCCCCCCCHHHHH
T ss_conf             4586499984-57888776999999999997189279995468887421557898988999