HHsearch alignment for GI: 254780806 and conserved domain: PRK05973

>PRK05973 replicative DNA helicase; Provisional.
Probab=93.46  E-value=0.2  Score=27.85  Aligned_cols=36  Identities=19%  Similarity=0.330  Sum_probs=31.7

Q ss_pred             EEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             998088988889999999999998799599998787
Q gi|254780806|r   10 TIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDP   45 (265)
Q Consensus        10 ~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~   45 (265)
T Consensus        67 IIlAARPsMGKTafaLnla~~A~k~g~~v~fFSLEM  102 (237)
T PRK05973         67 VLLGARPGQGKTLLGLELAVEAMKSGRTGVFFTLEY  102 (237)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             999428988789999999999999599669996159