HHsearch alignment for GI: 254780806 and conserved domain: PRK06278

>PRK06278 cobyrinic acid a,c-diamide synthase; Validated.
Probab=92.52  E-value=0.77  Score=24.39  Aligned_cols=168  Identities=16%  Similarity=0.215  Sum_probs=81.4

Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCC
Q ss_conf             87499998088988889999999999998799599998787768011212463334541167630257712102444444
Q gi|254780806|r    5 KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIP   84 (265)
Q Consensus         5 ~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~   84 (265)
T Consensus       243 ~kkgiiLl~TgS~SGKTFl~T~i~~kL~~---kvfv~KiGpD----------vRDIVPsLYl--l-rE~M~------ky~  300 (482)
T PRK06278        243 VKKGIILLATGSESGKTFLSTSIVSKLRG---KTFVSKIGPD----------VRDIVPSLYL--L-REPME------KYS  300 (482)
T ss_pred             CCCEEEEEECCCCCCCEEHHHHHHHHHCC---CEEEEECCCC----------HHHCCHHHHH--C-CCHHH------HCC
T ss_conf             99659998437877743116778887506---4899860886----------6652524631--0-42122------046


Q ss_pred             CEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEC--CCCCCCC----CCHHHHH---H-HCCCCCC
Q ss_conf             200014887457750001232222102333224765102782033101--3332222----1011233---1-0011111
Q gi|254780806|r   85 NLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCP--PSFNLLT----MNAMAAA---D-SILVPLQ  154 (265)
Q Consensus        85 ~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~p--p~~~~~~----~~al~aa---d-~viip~~  154 (265)
T Consensus       301 SIkI--~~r--------------GW~~~~efle~vk~sdYd~~iiEGVMgafTg~Ln~k~~YS~aeIak~lg~PvyivS~  364 (482)
T PRK06278        301 SIKI--SDR--------------GWMEPSEFLEFVKNSDYDNYIIEGVMGAFTGALNKKNPYSGAEIAKALGFPVYIVSS  364 (482)
T ss_pred             CEEE--CCC--------------CCCCHHHHHHHHHCCCCCEEEEEHHHHHHHHHHCCCCCCCHHHHHHHCCCCEEEEEC
T ss_conf             1685--467--------------876899999997347987899850478888875057887689999855998899942


Q ss_pred             CCCHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCC
Q ss_conf             231137888753-3577765543202677431002023125310011268999880852015
Q gi|254780806|r  155 CEFFALEGLSQL-LETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN  215 (265)
Q Consensus       155 p~~~s~~~~~~~-~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~  215 (265)
T Consensus       365 cnksGIEgAfve~~ay~slL-k--~~Gv~v~giILNKvYn-~~i-fekvk~~~~~~~i~~~~  421 (482)
T PRK06278        365 CSKGGIEGAFVELMAYYSLL-K--EMGVNVAGIILNKVYN-MEI-FEKVKKIASNLNINVIG  421 (482)
T ss_pred             CCCCCCHHHHHHHHHHHHHH-H--HCCCCEEEEEEEEECC-HHH-HHHHHHHHHHCCCEEEE
T ss_conf             55566047899999999999-8--6697358899741125-889-99999999865952986