HHsearch alignment for GI: 254780806 and conserved domain: PRK06731

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=98.66  E-value=1.4e-07  Score=63.73  Aligned_cols=43  Identities=30%  Similarity=0.356  Sum_probs=38.1

Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC
Q ss_conf             76874999980889888899999999999987995999987877
Q gi|254780806|r    3 EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQ   46 (265)
Q Consensus         3 ~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q   46 (265)
T Consensus        72 ~~~~~vI~lv-G~~G~GKTTT~AKLA~~~~~~~~kV~lia~Dty  114 (270)
T PRK06731         72 EKEVQTIALI-GPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHS  114 (270)
T ss_pred             CCCCEEEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             7998189998-889898899999999999867990899983888