HHsearch alignment for GI: 254780806 and conserved domain: PRK06995

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=98.53  E-value=2.8e-07  Score=62.02  Aligned_cols=170  Identities=20%  Similarity=0.251  Sum_probs=88.0

Q ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHHHH-CC-CCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCC
Q ss_conf             687499998088988889999999999998-79-9599998787768011212463334541167630257712102444
Q gi|254780806|r    4 KKSRIITIANQKGGVGKTTTAINLSTALAA-IG-ENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQT   81 (265)
Q Consensus         4 ~~~kvI~v~s~KGGvGKTT~a~nlA~~la~-~g-~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~   81 (265)
T Consensus       174 ~~ggV~alV-GPTGVGKTTTiAKLAAr~~l~~g~~kVaLIT~DTYRI-gAvEQ-------------------L-----kt  227 (404)
T PRK06995        174 ERGGVFALV-GPTGVGKTTTTAKLAARCVMRHGASKVALLTTDSYRI-GGHEQ-------------------L-----RI  227 (404)
T ss_pred             CCCCEEEEE-CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCH-HHHHH-------------------H-----HH
T ss_conf             147558986-6888763758999999999983898379997687547-89999-------------------9-----99


Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCC------CHHHHH---HHCCCC
Q ss_conf             44420001488745775000123222210233322476510278203310133322221------011233---100111
Q gi|254780806|r   82 AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTM------NAMAAA---DSILVP  152 (265)
Q Consensus        82 ~~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~------~al~aa---d~viip  152 (265)
T Consensus       228 Ya~I----------lgvPv~vv~~~---~eL~~aL~~-l-~~~dlILIDTaG-rs~rD~~~~e~l~~l~~~~~~~~~~LV  291 (404)
T PRK06995        228 YGKI----------LGVPVHAVKDA---ADLRLALAE-L-RNKHIVLIDTVG-MSQRDRMVSEQIAMLHGAGAPVQRLLL  291 (404)
T ss_pred             HHHH----------CCCEEEEECCH---HHHHHHHHH-H-CCCCEEEEECCC-CCCCCHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             9987----------59559995999---999999997-0-899999980999-897688899999999735788528999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCC----CCCCCCCCHHHHH
Q ss_conf             1123113788875335777655432026774310020231253100112689998808520----1562678688987
Q gi|254780806|r  153 LQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKV----YNTVIPRNVRISE  226 (265)
Q Consensus       153 ~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v----~~~~Ip~~~~i~~  226 (265)
T Consensus       292 Lsat~-~~~dl~~i---~~~f~-----~~~~~~~I~TKLDEt~~~G~-iln~~~~~-~lPlsy~T~GQ~VPeDi~~A~  358 (404)
T PRK06995        292 LNATS-HGDTLNEV---VQAYR-----GPGLAGCILTKLDEAASLGG-ALDTVIRH-KLPLHYVSNGQRVPEDLHVAN  358 (404)
T ss_pred             ECCCC-CHHHHHHH---HHHHC-----CCCCCEEEEECCCCCCCHHH-HHHHHHHH-CCCEEEECCCCCCCCCHHCCC
T ss_conf             77989-99999999---99844-----69998399830406797239-99999997-898599818995842121089