HHsearch alignment for GI: 254780806 and conserved domain: PRK07667

>PRK07667 uridine kinase; Provisional.
Probab=97.37  E-value=0.00036  Score=43.85  Aligned_cols=44  Identities=27%  Similarity=0.375  Sum_probs=35.6

Q ss_pred             CCCCCCE--EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
Q ss_conf             9876874--99998088988889999999999998799599998787
Q gi|254780806|r    1 MEEKKSR--IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDP   45 (265)
Q Consensus         1 ~~~~~~k--vI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~   45 (265)
T Consensus         7 ~~~~~~~r~iIgI-aG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd   52 (190)
T PRK07667          7 MKKHKENRFILGI-DGLSRSGKTTFVANLKENMKQEGIPFHIFHIDD   52 (190)
T ss_pred             HHHCCCCEEEEEE-ECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9857598699997-798978899999999999866598379996662