HHsearch alignment for GI: 254780806 and conserved domain: PRK08006

>PRK08006 replicative DNA helicase; Provisional.
Probab=93.97  E-value=0.17  Score=28.20  Aligned_cols=40  Identities=33%  Similarity=0.444  Sum_probs=32.5

Q ss_pred             CCEEEEEECCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCC
Q ss_conf             87499998088988889999999999998-799599998787
Q gi|254780806|r    5 KSRIITIANQKGGVGKTTTAINLSTALAA-IGENVLLIDLDP   45 (265)
Q Consensus         5 ~~kvI~v~s~KGGvGKTT~a~nlA~~la~-~g~rVllID~D~   45 (265)
T Consensus       223 ~G~Livi-aaRPsmGKTalalnia~~~a~~~~~~V~~fSlEM  263 (471)
T PRK08006        223 PSDLIIV-AARPSMGKTTFAMNLCENAAMLQDKPVLIFSLEM  263 (471)
T ss_pred             CCCEEEE-EECCCCCHHHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             1738999-9469987699999999999986699579981679