HHsearch alignment for GI: 254780806 and conserved domain: PRK11889

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional.
Probab=98.65  E-value=8.6e-08  Score=64.97  Aligned_cols=173  Identities=20%  Similarity=0.304  Sum_probs=87.9

Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCC
Q ss_conf             76874999980889888899999999999987995999987877680112124633345411676302577121024444
Q gi|254780806|r    3 EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTA   82 (265)
Q Consensus         3 ~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~   82 (265)
T Consensus       238 ~~~~q~IALV-GPTGVGKTTTIAKLAArf~~~~KkVALITtDTYRIGA-VEQL------KTYAe-----------I----  294 (436)
T PRK11889        238 EKEVQTIALI-GPTGVGKTTTLAKMAWQFHGKKKTVGFITTDHSRIGT-VQQL------QDYVK-----------T----  294 (436)
T ss_pred             HHHCEEEEEE-CCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHH-HHHH------HHHHH-----------H----
T ss_conf             6417179998-9999888999999999986169808999806634769-9999------99999-----------8----


Q ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHH--CCCCCCEEEECCCCCCC---CC----CHHHH--HHHCCC
Q ss_conf             442000148874577500012322221023332247651--02782033101333222---21----01123--310011
Q gi|254780806|r   83 IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT--SDFSYIFLDCPPSFNLL---TM----NAMAA--ADSILV  151 (265)
Q Consensus        83 ~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~--~~yD~IiiD~pp~~~~~---~~----~al~a--ad~vii  151 (265)
T Consensus       295 -MgVPV~VV------------~dp---~eL~~AL~-~lkdka~~DLILIDTAG-RS~RD~~~I~EL~~~l~~~~p~ev~L  356 (436)
T PRK11889        295 -IGFEVIAV------------RDE---AAMTRALT-YFKEEARVDYILIDTAG-KNYRASETVEEMIETMGQVEPDYICL  356 (436)
T ss_pred             -HCCCEEEE------------CCH---HHHHHHHH-HHHHCCCCCEEEEECCC-CCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             -49943996------------888---99999999-87633688889992989-88468999999999985127771699


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCC----CCCCCCCCHHHHHH
Q ss_conf             11123113788875335777655432026774310020231253100112689998808520----15626786889877
Q gi|254780806|r  152 PLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKV----YNTVIPRNVRISEA  227 (265)
Q Consensus       152 p~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v----~~~~Ip~~~~i~~a  227 (265)
T Consensus       357 VLSATT-K~~DL~e---Ii~rF~-----~l~idglIfTKLDET~SlG~-ILNv~~~-s~LPIsYvTdGQ~VPEDIevA~a  425 (436)
T PRK11889        357 TLSASM-KSKDMIE---IITNFK-----DIHIDGIVFTKFDETASSGE-LLKIPAV-SSAPIVLMTDGQDVKKNIHIATA  425 (436)
T ss_pred             EEECCC-CHHHHHH---HHHHHC-----CCCCCEEEEEECCCCCCCHH-HHHHHHH-HCCCEEEECCCCCCCCCHHHCCH
T ss_conf             997889-9899999---999725-----79988289971325687037-8889988-39987997899858753000699