HHsearch alignment for GI: 254780806 and conserved domain: PRK12724

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional.
Probab=98.61  E-value=1.6e-07  Score=63.41  Aligned_cols=169  Identities=15%  Similarity=0.211  Sum_probs=84.5

Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCC
Q ss_conf             7687499998088988889999999999998-799599998787768011212463334541167630257712102444
Q gi|254780806|r    3 EKKSRIITIANQKGGVGKTTTAINLSTALAA-IGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQT   81 (265)
Q Consensus         3 ~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~-~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~   81 (265)
T Consensus       220 ~~~~kvi~lV-GPTGVGKTTTiAKLAA~~~l~~~kkVaLIT~DTYR-IgAvEQL------------------------kt  273 (432)
T PRK12724        220 KNQRKVVFFV-GPTGSGKTTSIAKLAAKYFLHMGKSVSLYTTDNYR-IAAIEQL------------------------KR  273 (432)
T ss_pred             CCCCEEEEEE-CCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCC-HHHHHHH------------------------HH
T ss_conf             7776299998-99998889999999999999749927999526653-7799999------------------------99


Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCC------C-CHHHH---HH--HC
Q ss_conf             4442000148874577500012322221023332247651027820331013332222------1-01123---31--00
Q gi|254780806|r   82 AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLT------M-NAMAA---AD--SI  149 (265)
Q Consensus        82 ~~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~------~-~al~a---ad--~v  149 (265)
T Consensus       274 Ya~Il~-iPv-------~v--v~~---~~el~~al~---~~~~DlILIDTAGr-S~rd~~~~~eL~~ll~~~~~~~~ie~  336 (432)
T PRK12724        274 YADTMG-MPF-------YP--VKD---IKKFKETLA---RDGSELILIDTAGY-SHRNLEQLERMQSFYSCFGEKDSVEN  336 (432)
T ss_pred             HHHHHC-CCE-------EE--EEC---HHHHHHHHH---HCCCCEEEEECCCC-CCCCHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             999859-945-------99--518---999999998---56999999929998-97899999999999986366788517


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCC----CCCCCCCCHHHH
Q ss_conf             1111123113788875335777655432026774310020231253100112689998808520----156267868898
Q gi|254780806|r  150 LVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKV----YNTVIPRNVRIS  225 (265)
Q Consensus       150 iip~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v----~~~~Ip~~~~i~  225 (265)
T Consensus       337 ~LVLSaT-tk~~dl~~i---i~~f~-----~l~~~~lIfTKLDET~s~G~-ilni~~~-~~~PisYiT~GQ~VPdDI~~A  405 (432)
T PRK1272