HHsearch alignment for GI: 254780806 and conserved domain: PRK12740

>PRK12740 elongation factor G; Reviewed.
Probab=96.86  E-value=0.00084  Score=41.67  Aligned_cols=91  Identities=12%  Similarity=0.110  Sum_probs=59.0

Q ss_pred             CCCCCCEEEECCCCCC--CCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHH
Q ss_conf             0278203310133322--22101123310011111231137888753357776554320267743100202312531001
Q gi|254780806|r  122 SDFSYIFLDCPPSFNL--LTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQ  199 (265)
Q Consensus       122 ~~yD~IiiD~pp~~~~--~~~~al~aad~viip~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~  199 (265)
T Consensus        58 ~~~~iNlIDTPGHvDF~~EV~~aLrv~DgAvlvVDaveGV~~qT~~v---~r~a---~~~~lp~i-lvINKiDr~~a~~~  130 (670)
T PRK12740         58 KGHKINIIDTPGHVDFTGEVERALRVLDGAVVVVCAVGGVEVQTETV---WRYA---EEYGVPRI-AFVNKLDRAGADFR  130 (670)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHH---HHHH---HHCCCCEE-EEEECCCCCCCCHH
T ss_conf             99899999297975148999999998686899997899973789999---9999---98799969-99979789999989


Q ss_pred             HHHHHHHHHHCCCCCCCCCC
Q ss_conf             12689998808520156267
Q gi|254780806|r  200 QVVSDVRKNLGGKVYNTVIP  219 (265)
Q Consensus       200 ~~~~~l~~~~~~~v~~~~Ip  219 (265)
T Consensus       131 ~~l~~i~~~l~~~~~~~~~P  150 (670)
T PRK12740        131 RVLAQLQEALGAPVVPLQLP  150 (670)
T ss_pred             HHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999848983579855