HHsearch alignment for GI: 254780806 and conserved domain: PRK13705

>PRK13705 plasmid-partitioning protein SopA; Provisional.
Probab=100.00  E-value=0  Score=328.46  Aligned_cols=254  Identities=25%  Similarity=0.377  Sum_probs=204.7

Q ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEE-CCCCCCCCHHHCCCCCC---CCCCEEEEE-ECCCCHHH
Q ss_conf             87687499998088988889999999999998799599998-78776801121246333---454116763-02577121
Q gi|254780806|r    2 EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLID-LDPQGNASTGLGIELYD---RKYSSYDLL-IEEKNINQ   76 (265)
Q Consensus         2 ~~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID-~D~q~~~~~~l~~~~~~---~~~ti~~~l-~~~~~l~~   76 (265)
T Consensus       102 ~g~~~~VIAVaNqKGGvGKTTTavnLA~~LAl~G~RVLlID~LDPQanlT~~~G~~pd~~~~~~~tl~~~~~~~~~~~~~  181 (388)
T PRK13705        102 EDEFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAEDTLLPFYLGEKDDAAY  181 (388)
T ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCHHH
T ss_conf             99987289995278885599999999999997799089995878886564356888876656443024776146665545


Q ss_pred             CCCCCCCCCEEECCCCCCCCCCCCCCCCCC-------CCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHC
Q ss_conf             024444442000148874577500012322-------2210233322476510278203310133322221011233100
Q gi|254780806|r   77 ILIQTAIPNLSIIPSTMDLLGIEMILGGEK-------DRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSI  149 (265)
Q Consensus        77 ~i~~~~~~~l~iipa~~~~~~~~~~l~~~~-------~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~al~aad~v  149 (265)
T Consensus       182 ~I~~T~~~gLDlIPs~l~L~~~E~el~~~~~~~~~~~~~~~~Lr~aL~-~v~d~YD~IlIDcPPsLG~LTiNAL~AAd~v  260 (388)
T PRK13705        182 AIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLRLAIE-TVAHDYDVIVIDSAPNLGIGTINVVCAADVL  260 (388)
T ss_pred             EEECCCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH-HHHHCCCEEEEECCCCHHHHHHHHHHHHCEE
T ss_conf             043478899799708989999999997755312322258999999998-6250399999958971779999999980854


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHH---CCCCCCCCCCCEEECCCHHHHH-HHHHHHHHHCCCCCCCCCCCCHHHH
Q ss_conf             11111231137888753357776554320---2677431002023125310011-2689998808520156267868898
Q gi|254780806|r  150 LVPLQCEFFALEGLSQLLETVEEVRRTVN---SALDIQGIILTMFDSRNSLSQQ-VVSDVRKNLGGKVYNTVIPRNVRIS  225 (265)
Q Consensus       150 iip~~p~~~s~~~~~~~~~~i~~~~~~~~---~~~~~~~iv~N~~~~~~~~~~~-~~~~l~~~~~~~v~~~~Ip~~~~i~  225 (265)
T Consensus       261 lIPv~p~~lD~~S~~qFl~m~~~l~~~~~~~g~~~~-~r~L~Tr~e~~d~~q~~~m~~~lr~~fg~~vl~~~i~~S~aI~  339 (388)
T PRK13705        261 IVPTPAELFDYTSALQFFDMLRDLLKNVDLKGFEPD-VRILLTKYSNANGSQSPWMEEQIRDAWGSMVLKNVVRETDEVG  339 (388)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHH
T ss_conf             867894077699999999999999999875177763-4899872589998789999999999976777636225789998


Q ss_pred             HHHHCCCCEEEECCC---C-----HHHHHHHHHHHHHHHH
Q ss_conf             777379857999799---9-----8999999999999999
Q gi|254780806|r  226 EAPSYGKPAIIYDLK---C-----AGSQAYLKLASELIQQ  257 (265)
Q Consensus       226 ~a~~~g~pv~~~~p~---s-----~~a~~~~~la~el~~~  257 (265)
T Consensus       340 ~A~~~~~TlyE~~~~~~~~~~ty~RA~es~d~v~~Ei~~~  379 (388)
T PRK13705        340 KGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDR  379 (388)
T ss_pred             HHHHHCCCCEECCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7265207301024444657799999999999999999999