HHsearch alignment for GI: 254780806 and conserved domain: PRK13764

>PRK13764 ATPase; Provisional.
Probab=92.27  E-value=0.19  Score=27.92  Aligned_cols=39  Identities=26%  Similarity=0.322  Sum_probs=29.6

Q ss_pred             CCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             6874999980889888899999999999987995999987
Q gi|254780806|r    4 KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDL   43 (265)
Q Consensus         4 ~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~   43 (265)
T Consensus       257 ~~a~Gi-lIaG~PGaGKsTfaqalA~~~~~~g~iVKTmEs  295 (605)
T PRK13764        257 ERAEGI-LIAGAPGAGKSTFAQALAEFYADMGKIVKTMES  295 (605)
T ss_pred             HCCCEE-EEECCCCCCHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             336649-997799997789999999999847978983248