HHsearch alignment for GI: 254780806 and conserved domain: TIGR00455

>TIGR00455 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulphate. This domain contains an ATP binding P-loop motif .; GO: 0005524 ATP binding, 0016301 kinase activity, 0016772 transferase activity transferring phosphorus-containing groups, 0000103 sulfate assimilation.
Probab=97.74  E-value=3.3e-05  Score=49.90  Aligned_cols=57  Identities=28%  Similarity=0.316  Sum_probs=46.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCC-CCCCHHHCCCCCCCCCCEE
Q ss_conf             999980889888899999999999987995999987877-6801121246333454116
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQ-GNASTGLGIELYDRKYSSY   65 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q-~~~~~~l~~~~~~~~~ti~   65 (265)
T Consensus        21 vlWl-TGLSGsGKsTiA~Al~~~L~~~G~~~~~LDGDnvR~gL~~dLGFS~~DR~eNIR   78 (187)
T TIGR00455        21 VLWL-TGLSGSGKSTIANALEKKLEKKGYRVYVLDGDNVRHGLNKDLGFSEEDRKENIR   78 (187)
T ss_pred             EEEE-ECCCCCHHHHHHHHHHHHHHHCCCEEEEECCCEEECCCCCCCCCCHHHHCCCCC
T ss_conf             9851-168856357999999999996697499975863424778888888567056883