HHsearch alignment for GI: 254780806 and conserved domain: TIGR01281

>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. The light-independent (dark) form of protochlorophyllide reductase plays a key role in the ability of gymnosperms, algae, and photosynthetic bacteria to form chlorophyll in the dark. Genetic and sequence analyses have indicated that dark protochlorophyllide reductase consists of three protein subunits that exhibit significant sequence similarity to the three subunits of nitrogenase, which catalyzes the reductive formation of ammonia from dinitrogen. Dark protochlorophyllide reductase activity was shown to be dependent on the presence of all three subunits, ATP, and the reductant dithionite. The BchL peptide (ChlL in chloroplast and cyanobacteria) is an ATP-binding iron-sulphur protein of the dark form protochlorophyllide reductase, an enzyme similar to nitrogenase . ; GO: 0005524 ATP binding, 0016730 oxidoreductase activity acting on iron-sulfur proteins as donors, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction.
Probab=100.00  E-value=7.1e-32  Score=205.58  Aligned_cols=236  Identities=25%  Similarity=0.320  Sum_probs=188.8

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEEC----CCC--HHHCCCC
Q ss_conf             4999980889888899999999999987995999987877680112124633345411676302----577--1210244
Q gi|254780806|r    7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIE----EKN--INQILIQ   80 (265)
Q Consensus         7 kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~----~~~--l~~~i~~   80 (265)
T Consensus         1 ~~lAvY-GKGGiGKSTTssNLSvA~A~~GkkVlQIGCDPKhDSTFTLtg~L---~PTvidvL~~~~yH~E~v~~eD~iy-   75 (275)
T TIGR01281         1 MILAVY-GKGGIGKSTTSSNLSVALAKKGKKVLQIGCDPKHDSTFTLTGKL---IPTVIDVLDAVNYHYEDVEPEDVIY-   75 (275)
T ss_pred             CEEEEE-CCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCC---CCCEEEECCCCCCCEEECCCCCEEE-
T ss_conf             968886-38887700467899999984699189852578888774544741---6746442256763031033378778-


Q ss_pred             CCCCCEEECCCCCCCCCCCCCC--CCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHH----HHHHHCCCCCC
Q ss_conf             4444200014887457750001--23222210233322476510278203310133322221011----23310011111
Q gi|254780806|r   81 TAIPNLSIIPSTMDLLGIEMIL--GGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAM----AAADSILVPLQ  154 (265)
Q Consensus        81 ~~~~~l~iipa~~~~~~~~~~l--~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~al----~aad~viip~~  154 (265)
T Consensus        76 ~GY~GVd~vEaGGPPAGsGCGGYVVGeT--VKLLke-~--~~~~~yDVilFDV---LGDVVCGGFAaPL~YAd~aLvva~  147 (275)
T TIGR01281        76 TGYGGVDCVEAGGPPAGSGCGGYVVGET--VKLLKE-L--DVLDEYDVILFDV---LGDVVCGGFAAPLQYADYALVVAA  147 (275)
T ss_pred             ECCCCEEEEECCCCCCCCCCCCEEECCH--HHHHHH-C--CHHHHCCEEEEEE---CCCEEECCCCCHHHHHCCEEEEEC
T ss_conf             3468568871473689888987471522--455665-2--6334289799962---575551754641123212566610


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             23113788875335777655432026774310020231253100112689998808520156267868898777379857
Q gi|254780806|r  155 CEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPA  234 (265)
Q Consensus       155 p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~~~Ip~~~~i~~a~~~g~pv  234 (265)
T Consensus       148 NDFDalFAANRia~av~~K~~~-Gy~vkLAGiIaNR~~~~yGGGtdlle~F~~~~~~~~l~-~~P~~d~IR~SRl~g~Tl  225 (275)
T TIGR01281       148 NDFDALFAANRIAAAVREKAKS-GYDVKLAGIIANRVDKEYGGGTDLLEKFAERVGTPVLG-VVPRLDEIRRSRLKGKTL  225 (275)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCC-CCEEEEEEEEECCCCCCCCCCCCHHHHHHHHCCCCEEE-ECCCHHHCCHHHHCCCCE
T ss_conf             7721789999999999998417-97078732663121131178715689999862883220-077711102010158612


Q ss_pred             EEECCCC----HHHHHHHHHHHHHHHH
Q ss_conf             9997999----8999999999999999
Q gi|254780806|r  235 IIYDLKC----AGSQAYLKLASELIQQ  257 (265)
Q Consensus       235 ~~~~p~s----~~a~~~~~la~el~~~  257 (265)
T Consensus       226 FEmee~~p~~~~~~~~y~~~A~~LL~~  252 (275)
T TIGR01281       226 FEMEESGPELEEVTAEYLKMAEYLLAK  252 (275)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHHHC
T ss_conf             301589965889999999999999863