HHsearch alignment for GI: 254780806 and conserved domain: TIGR01618

>TIGR01618 phage_P_loop phage nucleotide-binding protein; InterPro: IPR006505 These sequences represent an uncharacterised family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of these proteins is unknown..
Probab=96.20  E-value=0.0033  Score=38.19  Aligned_cols=106  Identities=22%  Similarity=0.186  Sum_probs=54.4

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCCCEE
Q ss_conf             99998088988889999999999998799599998787768011212463334541167630257712102444444200
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLS   87 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~~l~   87 (265)
T Consensus        15 ~~lIY-G~~G~GKTS~~K~l~------G-ktL~l~~D~S---SkVL---------------~------------G~~nvd   56 (229)
T TIGR01618        15 RYLIY-GKPGLGKTSTIKYLP------G-KTLVLSLDKS---SKVL---------------A------------GDENVD   56 (229)
T ss_pred             EEEEE-CCCCCCCCCEEEECC------C-CEEEEECCCC---CCCC---------------C------------CCCCCE
T ss_conf             68887-589887230566458------8-7898836786---4434---------------6------------899833


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCHHHHHHH---HHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHCCCC-CCCCCHHHHHH
Q ss_conf             01488745775000123222210233322---476510278203310133322221011233100111-11231137888
Q gi|254780806|r   88 IIPSTMDLLGIEMILGGEKDRLFRLDKAL---SVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVP-LQCEFFALEGL  163 (265)
Q Consensus        88 iipa~~~~~~~~~~l~~~~~~~~~l~~~l---~~~l~~~yD~IiiD~pp~~~~~~~~al~aad~viip-~~p~~~s~~~~  163 (265)
T Consensus        57 iim~~~d~~~~----------~~~~~e~~~~~~~~~~~~Y~niViDN---is~lq~~~L~~~gr~~K~~~~p~~q~Y~~~  123 (229)
T TIGR01618        57 IIMADLDDEKP----------IQEMVEFYKELQNIQAEEYDNIVIDN---ISELQKLWLINLGREAKNGRSPELQHYQKL  123 (229)
T ss_pred             EEEEEECCCCC----------HHHHHHHHHHHHCCHHHCCCEEEEEC---HHHHHHHHHHHCCCCCCCCCCCCCCCHHHH
T ss_conf             89986069984----------78999999997322534576589814---278999999846844245788650003688


Q ss_pred             H
Q ss_conf             7
Q gi|254780806|r  164 S  164 (265)
Q Consensus       164 ~  164 (265)
T Consensus       124 ~  124 (229)
T TIGR01618       124 D  124 (229)
T ss_pred             H
T ss_conf             8