HHsearch alignment for GI: 254780806 and conserved domain: TIGR03453

>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=100.00  E-value=0  Score=358.23  Aligned_cols=254  Identities=25%  Similarity=0.402  Sum_probs=209.4

Q ss_pred             CCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCC---CCCCCEEEEEE---CCCCHH
Q ss_conf             876874999980889888899999999999987995999987877680112124633---34541167630---257712
Q gi|254780806|r    2 EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELY---DRKYSSYDLLI---EEKNIN   75 (265)
Q Consensus         2 ~~~~~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~---~~~~ti~~~l~---~~~~l~   75 (265)
T Consensus       100 ~g~~~~VIav~N~KGGVGKTTtav~LA~~LA~~G~RVLvIDLDPQanlT~~~G~~pe~d~~~~~tl~~~l~~d~~~~~l~  179 (387)
T TIGR03453       100 GGEHLQVIAVTNFKGGSGKTTTSAHLAQYLALRGYRVLAIDLDPQASLSALFGFQPEFDVGENETLYGAIRYDDERRPLS  179 (387)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCHH
T ss_conf             99988089997888765699999999999997799889995370167887528984346675642999984455668799


Q ss_pred             HCCCCCCCCCEEECCCCCCCCCCCCCCC----CCCCC----CHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHH
Q ss_conf             1024444442000148874577500012----32222----102333224765102782033101333222210112331
Q gi|254780806|r   76 QILIQTAIPNLSIIPSTMDLLGIEMILG----GEKDR----LFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAAD  147 (265)
Q Consensus        76 ~~i~~~~~~~l~iipa~~~~~~~~~~l~----~~~~~----~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~al~aad  147 (265)
T Consensus       180 ~~i~~T~~~~LdliPa~~~L~~~E~~~~~~l~~~~~~~~~f~~rL~~aL~-~v~d~YD~IlIDcPPsLg~lT~nAL~AAd  258 (387)
T TIGR03453       180 EIIRKTYFPGLDLIPGNLELMEFEHETPRALSRGAGGDTIFFARVGEALA-EVEDDYDVVVIDCPPQLGFLTLSALCAAT  258 (387)
T ss_pred             HHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH-HHHCCCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             96114799996896598899998898899997431100269999999999-76602999999589851399999999819


Q ss_pred             HCCCCCCCCCHHHHHHHHHHHHHHHHHHH-----HHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCH
Q ss_conf             00111112311378887533577765543-----2026774310020231253100112689998808520156267868
Q gi|254780806|r  148 SILVPLQCEFFALEGLSQLLETVEEVRRT-----VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNV  222 (265)
Q Consensus       148 ~viip~~p~~~s~~~~~~~~~~i~~~~~~-----~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~~~Ip~~~  222 (265)
T Consensus       259 ~vlIPv~p~~ld~~s~~qfl~~~~~l~~~i~~~g~~~~~d~~~~LlT~~d~~~~~~~~v~~~~r~~fg~~vl~~~i~~S~  338 (387)
T TIGR03453       259 AVLITVHPQMLDVMSMSQFLLMTGDLLGVVRDAGGNLSYDWMRYLVTRYEPNDGPQAQMVAFMRSLFGEHVLTNPMLKST  338 (387)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHCCEEEHHH
T ss_conf             40878887177799999999999999999997167767640577645178998469999999999850654236201679


Q ss_pred             HHHHHHHCCCCEEEECCCCH-------HHHHHHHHHHHHHH
Q ss_conf             89877737985799979998-------99999999999999
Q gi|254780806|r  223 RISEAPSYGKPAIIYDLKCA-------GSQAYLKLASELIQ  256 (265)
Q Consensus       223 ~i~~a~~~g~pv~~~~p~s~-------~a~~~~~la~el~~  256 (265)
T Consensus       339 ai~~A~~~~~TiyE~~~~~~~r~ty~Ra~e~~d~v~~ei~~  379 (387)
T TIGR03453       339 AISDAGLTKQTLYEVERSQFTRSTYDRAMESLDAVNAEIEG  379 (387)
T ss_pred             HHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99863763793598774658989999999999999999999