HHsearch alignment for GI: 254780806 and conserved domain: cd01393

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.
Probab=94.07  E-value=0.12  Score=29.07  Aligned_cols=37  Identities=30%  Similarity=0.316  Sum_probs=29.9

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCC------CCEEEEECC
Q ss_conf             9999808898888999999999999879------959999878
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAIG------ENVLLIDLD   44 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~g------~rVllID~D   44 (265)
T Consensus        20 ~ItEi~G~~gsGKT~l~lqla~~~q~~~~~~~~~g~vvyIDtE   62 (226)
T cd01393          20 RITEIFGEFGSGKTQLCLQLAVEAQLPGELGGLEGKVVYIDTE   62 (226)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECC
T ss_conf             3999999999989999999999985422116999619999557