HHsearch alignment for GI: 254780806 and conserved domain: cd01983

>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=99.68  E-value=9.7e-17  Score=117.22  Aligned_cols=78  Identities=44%  Similarity=0.678  Sum_probs=70.6

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCCCEE
Q ss_conf             99998088988889999999999998799599998787768011212463334541167630257712102444444200
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLS   87 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~~l~   87 (265)
T Consensus         1 ~i~~~~~k-GvGKTT~a~~La~~la~~g~~Vl~vD---------------------------------------------   34 (99)
T cd01983           1 VIVVTGKG-GVGKTTLAANLAAALAKRGKRVLLID---------------------------------------------   34 (99)
T ss_pred             CEEEECCC-CCCHHHHHHHHHHHHHHCCCEEEEEC---------------------------------------------
T ss_conf             98985899-77689999999999998899699986---------------------------------------------


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCC---CCHHHHHHHCCCCCCCCCHHHHHHH
Q ss_conf             0148874577500012322221023332247651027820331013332222---1011233100111112311378887
Q gi|254780806|r   88 IIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLT---MNAMAAADSILVPLQCEFFALEGLS  164 (265)
Q Consensus        88 iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~---~~al~aad~viip~~p~~~s~~~~~  164 (265)
T Consensus        35 -------------------------------------d~iiiD~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~   77 (99)
T cd01983          35 -------------------------------------DYVLIDTPPGLGLLVLLCLLALLAADLVIIVTTPEALAVLGAR   77 (99)
T ss_pred             -------------------------------------CCEEECCCCCCCHHHHHHHHHHHHCCEEEEECCCCHHHHHHHH
T ss_conf             -------------------------------------7178858998884689999878758958996598488999999


Q ss_pred             HHHH
Q ss_conf             5335
Q gi|254780806|r  165 QLLE  168 (265)
Q Consensus       165 ~~~~  168 (265)
T Consensus        78 ~~~~   81 (99)
T cd01983          78 RLTE   81 (99)
T ss_pred             HHHH
T ss_conf             9999