HHsearch alignment for GI: 254780806 and conserved domain: cd02025

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=92.68  E-value=0.27  Score=27.06  Aligned_cols=37  Identities=46%  Similarity=0.413  Sum_probs=29.7

Q ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHC--CCCEEEEECCC
Q ss_conf             999980889888899999999999987--99599998787
Q gi|254780806|r    8 IITIANQKGGVGKTTTAINLSTALAAI--GENVLLIDLDP   45 (265)
Q Consensus         8 vI~v~s~KGGvGKTT~a~nlA~~la~~--g~rVllID~D~   45 (265)
T Consensus         1 IIGIa-G~sgSGKST~a~~l~~~l~~~~~~~~v~ii~~D~   39 (220)
T cd02025           1 IIGIA-GSVAVGKSTTARVLQALLSRWPDHPNVELITTDG   39 (220)
T ss_pred             CEEEE-CCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             98978-8998779999999999860026999489997878