HHsearch alignment for GI: 254780806 and conserved domain: cd03110

>cd03110 Fer4_NifH_child This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.
Probab=99.97  E-value=3e-32  Score=207.73  Aligned_cols=177  Identities=23%  Similarity=0.281  Sum_probs=120.4

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-CCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCCCEE
Q ss_conf             999808898888999999999999879959999878776-8011212463334541167630257712102444444200
Q gi|254780806|r    9 ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQG-NASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLS   87 (265)
Q Consensus         9 I~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~-~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~~l~   87 (265)
T Consensus         2 IaV~SgKGGVGKTT~a~nLA~----~l~~V~liD~D~~~~n~~~~l~~~~~~~-~~~~~~---~~~------------~~   61 (179)
T cd03110           2 IAVISGKGGTGKTTVTAALAA----LLKNVVLADCDVDAPNLHLFLKPEIEEE-EDFIVG---GKK------------AV   61 (179)
T ss_pred             EEEEECCCCCHHHHHHHHHHH----HCCCCEEEEECCCCCCHHHHCCCCCCCC-EEEEEC---CCC------------CE
T ss_conf             899958998609999999999----7428719994189985777718765632-122304---653------------35


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHHH
Q ss_conf             01488745775000123222210233322476510278203310133322221011233100111112311378887533
Q gi|254780806|r   88 IIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLL  167 (265)
Q Consensus        88 iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~al~aad~viip~~p~~~s~~~~~~~~  167 (265)
T Consensus        62 ~~~~~~~~~g~~~~~~-----~~~~~~~~~~~~~~~~D~viiD~Ppg~~~~~~~al~~ad~~iiVttP~~~si~d~~r~i  136 (179)
T cd03110          62 IDPELCISCGLCGKLV-----TEVRKHAKEIAKAEGAELIIIDGPPGIGCPVIASLTGADAALLVTEPTPSGLHDLERAV  136 (179)
T ss_pred             ECHHHHHHCCCHHHHH-----HHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHCCCEEEEECCCCHHHHHHHHHHH
T ss_conf             1506653235176889-----99999999986443799899818999757899999739949998199478999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             5777655432026774310020231253100112689998808520156267
Q gi|254780806|r  168 ETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIP  219 (265)
Q Consensus       168 ~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~~~Ip  219 (265)
T Consensus       137 ~l~~~~----~~--~~-gvV~Nr~~~~~~~~~~-i~~~~~~~~vp~LG-~iP  179 (179)
T cd03110         137 ELVRHF----GI--PV-GVVINKYDLNDEIAEE-IEDYCEEEGIPILG-KIP  179 (179)
T ss_pred             HHHHHC----CC--CE-EEEEECCCCCCCCHHH-HHHHHHHHCCCEEE-ECC
T ss_conf             999982----99--78-9999688788763489-99999980999898-387