HHsearch alignment for GI: 254780806 and conserved domain: pfam00142

>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family.
Probab=100.00  E-value=0  Score=297.81  Aligned_cols=241  Identities=20%  Similarity=0.327  Sum_probs=178.9

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCC-CCHHHCCCCCCCCCCEEEEEECCCCHHHC----CCCC
Q ss_conf             499998088988889999999999998799599998787768-01121246333454116763025771210----2444
Q gi|254780806|r    7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGN-ASTGLGIELYDRKYSSYDLLIEEKNINQI----LIQT   81 (265)
Q Consensus         7 kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~-~~~~l~~~~~~~~~ti~~~l~~~~~l~~~----i~~~   81 (265)
T Consensus         1 r~iai-~GKGGVGKTTtsvNLA~aLA~~GkrVlliDaD~~~~~~~~llg~~~---~~~l~d~l~~~~~~~~~~~~~vi~~   76 (269)
T pfam00142         1 RKIAI-YGKGGIGKSTTSQNTSAALAEMGKKVLIVGCDPKADSTRLILGGKA---QPTIIDTLREKGLVEDVELEDVVKK   76 (269)
T ss_pred             CEEEE-ECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHCCCCC---CCCHHHHHCCCCCCCCCCHHHHEEC
T ss_conf             95899-8999768899999999999987990999845899874144438988---8847877604677022407450133


Q ss_pred             CCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHH-HHHHCCCCCCEEEECCCCCC---CCCCHHHHHHHCCCCCCCCC
Q ss_conf             444200014887457750001232222102333224-76510278203310133322---22101123310011111231
Q gi|254780806|r   82 AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLTSDFSYIFLDCPPSFNL---LTMNAMAAADSILVPLQCEF  157 (265)
Q Consensus        82 ~~~~l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~-~~l~~~yD~IiiD~pp~~~~---~~~~al~aad~viip~~p~~  157 (265)
T Consensus        77 ~~~gv~~i~~~~~e~~~~~--~~--~~~~~~~~~l~~~~~~~~~DyiliD~~g~~~~~~~~~~i~~~~A~~viiv~t~E~  152 (269)
T pfam00142        77 GYGGIRCVESGGPEPGVGC--AG--RGVITAIDLLEELGAYDDLDFVLYDVLGDVVCGGFAMPIREGKAQEVYIVTSGEM  152 (269)
T ss_pred             CCCCCEEEECCCCCCCCCC--CH--HHHHHHHHHHHHHCCHHCCCEEEEECCCCEEECCCCCCHHHCCCCEEEEEECCCH
T ss_conf             7787268868998656321--10--7899999999982102128889853367402434005334435887999828947


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             13788875335777655432026774310020231253100112689998808520156267868898777379857999
Q gi|254780806|r  158 FALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY  237 (265)
Q Consensus       158 ~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v~~~~Ip~~~~i~~a~~~g~pv~~~  237 (265)
T Consensus       153 ~al~~a~~l~~~i~~~~~~~--~~~i~giv~n~~--~~~~~~~~~~~~~~~~~~~~lg-~IP~d~~v~eA~~~g~pv~~~  227 (269)
T pfam00142       153 MALYAANNICKGILKYAKSG--GVRLGGLICNSR--KVDDERELIDAFAEALGTQMIH-FVPRDNIVQKAELNKQTVIEY  227 (269)
T ss_pred             HHHHHHHHHHHHHHHHHCCC--CCEEEEEEECCC--CCCHHHHHHHHHHHHHCCCEEE-ECCCCHHHHHHHHCCCCEEEE
T ss_conf             89999999999999985057--962789982686--5411579999999981994799-779982687542349817998


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             79998999999999999999986
Q gi|254780806|r  238 DLKCAGSQAYLKLASELIQQERH  260 (265)
Q Consensus       238 ~p~s~~a~~~~~la~el~~~~~~  260 (265)
T Consensus       228 ~P~S~~A~ay~~LA~~il~~~~~  250 (269)
T pfam00142       228 APTCNQAKEYRELARKIIENPEG  250 (269)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99998999999999999858999