HHsearch alignment for GI: 254780806 and conserved domain: pfam00448

>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=98.84  E-value=1.9e-08  Score=68.77  Aligned_cols=161  Identities=22%  Similarity=0.266  Sum_probs=81.0

Q ss_pred             CEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCCC
Q ss_conf             74999980889888899999999999987995999987877680112124633345411676302577121024444442
Q gi|254780806|r    6 SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPN   85 (265)
Q Consensus         6 ~kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~~   85 (265)
T Consensus         1 P~vi~lv-GptGvGKTTTiaKLAa~~~~~~~~V~lit~Dt~R~gA~-eQL~------~ya~----------------~l~   56 (196)
T pfam00448         1 PNVILLV-GLQGSGKTTTIAKLAAYLKKQGKKVLLVAADTFRAAAI-EQLK------QLAE----------------RLG   56 (196)
T ss_pred             CEEEEEE-CCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHH-HHHH------HHHH----------------HCC
T ss_conf             9699998-99999889999999999997799289997587768899-9999------9998----------------639


Q ss_pred             EEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCC---CCHH------HHHHHCCCCCCCC
Q ss_conf             000148874577500012322221023332247651027820331013332222---1011------2331001111123
Q gi|254780806|r   86 LSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLT---MNAM------AAADSILVPLQCE  156 (265)
Q Consensus        86 l~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~---~~al------~aad~viip~~p~  156 (265)
T Consensus        57 v~~~~~~~-----------~~d~~~~~~~~l~~~~~~~~D~IlIDTaG-r~~~d~~~~~el~~~~~~~~~~~~~LVl~a~  124 (196)
T pfam00448        57 VPVFGSGT-----------GSDPAAVAFDAVEKAKAENYDVVLVDTAG-RLQNDKNLMDELKKIKRVIAPDEVLLVLDAT  124 (196)
T ss_pred             CEEEECCC-----------CCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCCCCHHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             81781487-----------77878999999999884689999998999-8747677899999998522873028998567


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCC
Q ss_conf             113788875335777655432026774310020231253100112689998808520
Q gi|254780806|r  157 FFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKV  213 (265)
Q Consensus       157 ~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~~~~~~l~~~~~~~v  213 (265)
T Consensus       125 ~~-~~~~~~----~~~f----~~~~~~~~~I~TKlDet~~~G~-~l~~~~~-~~~Pi  170 (196)
T pfam00448       125 TG-QNALNQ----AKAF----NEAVGITGVILTKLDGDAKGGA-ALSIAAE-TGKPI  170 (196)
T ss_pred             CC-CCHHHH----HHHH----HHHCCCCCEEEEEECCCCCCCH-HHHHHHH-HCCCE
T ss_conf             78-213789----9987----6004776268884057887529-9989999-89697