HHsearch alignment for GI: 254780806 and conserved domain: pfam01695

>pfam01695 IstB IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.
Probab=95.24  E-value=0.044  Score=31.67  Aligned_cols=36  Identities=28%  Similarity=0.290  Sum_probs=30.6

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             4999980889888899999999999987995999987
Q gi|254780806|r    7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDL   43 (265)
Q Consensus         7 kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~   43 (265)
T Consensus        48 ~Nlll-~G~~GtGKThLA~Ai~~~~~~~g~~v~f~~~   83 (178)
T pfam01695        48 ENLLL-LGPPGVGKTHLACALGHQACRAGYSVLFTRT   83 (178)
T ss_pred             CCEEE-ECCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             76899-8999987899999999999986985999961