HHsearch alignment for GI: 254780806 and conserved domain: pfam06745

>pfam06745 KaiC KaiC. This family represents a conserved region within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein. This family includes KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria.
Probab=93.35  E-value=0.2  Score=27.77  Aligned_cols=36  Identities=22%  Similarity=0.322  Sum_probs=29.8

Q ss_pred             EEEECCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECC
Q ss_conf             999808898888999999999999-879959999878
Q gi|254780806|r    9 ITIANQKGGVGKTTTAINLSTALA-AIGENVLLIDLD   44 (265)
Q Consensus         9 I~v~s~KGGvGKTT~a~nlA~~la-~~g~rVllID~D   44 (265)
T Consensus        21 ~~LI~G~pGsGKT~la~qfl~~ga~~~ge~~lYis~e   57 (231)
T pfam06745        21 VVLITGGPGTGKTIFGLQFLYNGALEYGEPGVYVTLE   57 (231)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             9999858972599999999999998658968999813