HHsearch alignment for GI: 254780806 and conserved domain: pfam07015

>pfam07015 VirC1 VirC1 protein. This family consists of several bacterial VirC1 proteins. In Agrobacterium tumefaciens, a cis-active 24-base-pair sequence adjacent to the right border of the T-DNA, called overdrive, stimulates tumour formation by increasing the level of T-DNA processing. It is thought that the virC operon which enhances T-DNA processing probably does so because the VirC1 protein interacts with overdrive. It has now been shown that the virC1 gene product binds to overdrive but not to the right border of T-DNA.
Probab=100.00  E-value=3.7e-33  Score=213.07  Aligned_cols=212  Identities=22%  Similarity=0.231  Sum_probs=153.0

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHCCCCCCCCCCEEEEEECCCCHHHCCCCCCCCCE
Q ss_conf             49999808898888999999999999879959999878776801121246333454116763025771210244444420
Q gi|254780806|r    7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNL   86 (265)
Q Consensus         7 kvI~v~s~KGGvGKTT~a~nlA~~la~~g~rVllID~D~q~~~~~~l~~~~~~~~~ti~~~l~~~~~l~~~i~~~~~~~l   86 (265)
T Consensus         2 ~vi~~~~~KGG~GKtT~a~~la~~~~~~g~~V~liD~Dpq~s~~~W~~~a~~~---~~---------~~--------~~~   61 (231)
T pfam07015         2 QLITFCSFKGGAGKTTALMGLCSALASDGKRVALFEADENRPLTKWRENALRK---GT---------WD--------PAC   61 (231)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHC---CC---------CC--------CCC
T ss_conf             37999617998659999999999999689959999689986889999987646---88---------88--------765


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHH
Q ss_conf             00148874577500012322221023332247651027820331013332222101123310011111231137888753
Q gi|254780806|r   87 SIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQL  166 (265)
Q Consensus        87 ~iipa~~~~~~~~~~l~~~~~~~~~l~~~l~~~l~~~yD~IiiD~pp~~~~~~~~al~aad~viip~~p~~~s~~~~~~~  166 (265)
T Consensus        62 ~v~~~~---------------~~~~l~~~~~~~~~~~yD~VIIDtpg~~s~~~~~AI~~ADlVLIP~qpSplD~~~a~~t  126 (231)
T pfam07015        62 EIFNAD---------------ELPLLEQAYEHAEGSGFDYALADTHGGSSELNNTIIASSDLLLIPTMLTPLDIDEALAT  126 (231)
T ss_pred             CEECCC---------------CHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCEEEECCCCCHHHHHHHHHH
T ss_conf             222056---------------60158999998865799989983998575899999997898997789982339999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCEEECCCHHH-HHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCCCCEEEECCCC----
Q ss_conf             35777655432026774310020231253100-1126899988085201562678688987773798579997999----
Q gi|254780806|r  167 LETVEEVRRTVNSALDIQGIILTMFDSRNSLS-QQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC----  241 (265)
Q Consensus       167 ~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~-~~~~~~l~~~~~~~v~~~~Ip~~~~i~~a~~~g~pv~~~~p~s----  241 (265)
T Consensus       127 ~~~i~~~~~~~~~~ip~-avl~tRv~~~~~~~~~~~i~e~le~--lpvl~t~i~eR~AF~~if~~G~l~~~l~~~~~~~~  203 (231)
T pfam07015       127 YRYVIELLLTENLAIPT-AILRQRVPVGRLTSSQRFCSDMLEQ--LPVFDCPMHERDAFAAMKERGMLHITLENLSQIPS  203 (231)
T ss_pred             HHHHHHHHHHHCCCCCE-EEEEEECCCCCCCHHHHHHHHHHHC--CCCCCCCCCCHHHHHHHHHHCCCCHHCCCCCCCCC
T ss_conf             99999999973789980-3345511400021789999999964--98543542028999999980462000268777851


Q ss_pred             --HHHHHHHHHHHHHHH
Q ss_conf             --899999999999999
Q gi|254780806|r  242 --AGSQAYLKLASELIQ  256 (265)
Q Consensus       242 --~~a~~~~~la~el~~  256 (265)
T Consensus       204 ~~~a~~n~~~~~~e~~~  220 (231)
T pfam07015       204 MRLALRNLRTAMEDLDR  220 (231)
T ss_pred             HHHHHHHHHHHHHHHHH
T ss_conf             12899999999999999