BLAST/PSIBLAST alignment of GI: 254780806 and GI: 116254460 at iteration 1
>gi|116254460|ref|YP_770298.1| chromosome partitioning protein [Rhizobium leguminosarum bv. viciae 3841] Length = 264
>gi|115259108|emb|CAK10219.1| putative chromosome partitioning protein [Rhizobium leguminosarum bv. viciae 3841] Length = 264
 Score =  411 bits (1056), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 231/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ ++ I ++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGDRGIPEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264