BLAST/PSIBLAST alignment of GI: 254780806 and GI: 222087926 at iteration 1
>gi|222087926|ref|YP_002546464.1| chromosome partitioning protein A [Agrobacterium radiobacter K84] Length = 271
>gi|221725374|gb|ACM28530.1| chromosome partitioning protein A [Agrobacterium radiobacter K84] Length = 271
 Score =  410 bits (1054), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 233/265 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +++RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 7   MIGERNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 66

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDLL+    I   + +TA+PNL I+PSTMDLLG+EM +  + DR+FRL +AL+   
Sbjct: 67  KVSSYDLLVGTHTILDTVQETAVPNLYIVPSTMDLLGVEMEIAQQPDRVFRLRRALNGAG 126

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
            + FSYI +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VRRTVN +
Sbjct: 127 ATAFSYILVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRRTVNPS 186

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFDSRN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 187 LDIQGIVLTMFDSRNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 246

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
           CAGSQAYL+LASE+IQ+ER RK AA
Sbjct: 247 CAGSQAYLQLASEVIQRERQRKAAA 271