BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780806|ref|YP_003065219.1| chromosome partitioning
protein A [Candidatus Liberibacter asiaticus str. psy62]
         (265 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780806|ref|YP_003065219.1| chromosome partitioning protein A [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040483|gb|ACT57279.1| chromosome partitioning protein A [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 265

 Score =  536 bits (1381), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 265/265 (100%), Positives = 265/265 (100%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR
Sbjct: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL
Sbjct: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
           TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA
Sbjct: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK
Sbjct: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
           CAGSQAYLKLASELIQQERHRKEAA
Sbjct: 241 CAGSQAYLKLASELIQQERHRKEAA 265


>gi|315122029|ref|YP_004062518.1| chromosome partitioning protein A [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495431|gb|ADR52030.1| chromosome partitioning protein A [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 265

 Score =  483 bits (1244), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/263 (90%), Positives = 249/263 (94%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           MEEK +RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL DR
Sbjct: 1   MEEKNTRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELQDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           +YSSY++LI EK ++Q+LI T+IPNLSIIPSTMDLLGIEM LGGEKDRLFRLDKAL+V+L
Sbjct: 61  EYSSYEVLIGEKGVDQVLINTSIPNLSIIPSTMDLLGIEMRLGGEKDRLFRLDKALNVKL 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYIFLDCPPSFNLLTMNAM AADSILVPLQCEFFALEGLSQLLETVEEVRRTVN  
Sbjct: 121 NKKFSYIFLDCPPSFNLLTMNAMVAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNLE 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGIILTMFDSRNSLSQQVVSDVRKNLG KVYNTVIPRNVRISEAPSYGKPAIIYDLK
Sbjct: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGEKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKE 263
           CAGSQAYLKLASE+IQQER RKE
Sbjct: 241 CAGSQAYLKLASEIIQQERQRKE 263


>gi|190893976|ref|YP_001980518.1| chromosome partitioning protein A [Rhizobium etli CIAT 652]
 gi|190699255|gb|ACE93340.1| chromosome partitioning protein A [Rhizobium etli CIAT 652]
          Length = 264

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 232/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ E+ I+++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGERGISEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSTPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMGFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRVAA 264


>gi|327191203|gb|EGE58246.1| chromosome partitioning protein A [Rhizobium etli CNPAF512]
          Length = 264

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 232/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ E+ I+++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGERGISEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSTPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMGFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|209551499|ref|YP_002283416.1| cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537255|gb|ACI57190.1| Cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 264

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 231/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL+I E+ I ++ ++TA+PNL I+PSTMDLLG+EM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMIGERGITEVTLETAVPNLFIVPSTMDLLGVEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|218682744|ref|ZP_03530345.1| chromosome partitioning protein A [Rhizobium etli CIAT 894]
          Length = 264

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 230/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +K RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGEKHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ E++I  + ++ A+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGERSIRDVTLEAAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMTFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|227823853|ref|YP_002827826.1| cobyrinic acid a,c-diamide synthase [Sinorhizobium fredii NGR234]
 gi|227342855|gb|ACP27073.1| cobyrinic acid a,c-diamide synthase [Sinorhizobium fredii NGR234]
          Length = 264

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 231/260 (88%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR  SS
Sbjct: 5   RNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIQRRDRHLSS 64

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y+L++   +I  I ++TA+PNL+I+PSTMDLLG+EM +  E DR+FRL KAL+      +
Sbjct: 65  YELMMGTHSIGAIALETAVPNLTIVPSTMDLLGVEMEISRESDRVFRLRKALAAPEALAY 124

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           SY+ +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VRRTVN +LDIQ
Sbjct: 125 SYVLVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRRTVNPSLDIQ 184

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFDSRN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLKCAGS
Sbjct: 185 GIVLTMFDSRNNLAQQVVSDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGS 244

Query: 245 QAYLKLASELIQQERHRKEA 264
           QAYL+LASE+IQ+ER RK A
Sbjct: 245 QAYLQLASEVIQRERQRKAA 264


>gi|241206937|ref|YP_002978033.1| Cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860827|gb|ACS58494.1| Cobyrinic acid ac-diamide synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 264

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/264 (74%), Positives = 231/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL+I ++ I ++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMIGDRGIPEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|116254460|ref|YP_770298.1| chromosome partitioning protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259108|emb|CAK10219.1| putative chromosome partitioning protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 264

 Score =  411 bits (1056), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 231/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ ++ I ++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGDRGIPEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|222087926|ref|YP_002546464.1| chromosome partitioning protein A [Agrobacterium radiobacter K84]
 gi|221725374|gb|ACM28530.1| chromosome partitioning protein A [Agrobacterium radiobacter K84]
          Length = 271

 Score =  410 bits (1054), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/265 (74%), Positives = 233/265 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +++RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 7   MIGERNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 66

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDLL+    I   + +TA+PNL I+PSTMDLLG+EM +  + DR+FRL +AL+   
Sbjct: 67  KVSSYDLLVGTHTILDTVQETAVPNLYIVPSTMDLLGVEMEIAQQPDRVFRLRRALNGAG 126

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
            + FSYI +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VRRTVN +
Sbjct: 127 ATAFSYILVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRRTVNPS 186

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFDSRN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 187 LDIQGIVLTMFDSRNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 246

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
           CAGSQAYL+LASE+IQ+ER RK AA
Sbjct: 247 CAGSQAYLQLASEVIQRERQRKAAA 271


>gi|86359698|ref|YP_471590.1| chromosome partitioning protein A [Rhizobium etli CFN 42]
 gi|86283800|gb|ABC92863.1| chromosome partitioning protein A [Rhizobium etli CFN 42]
          Length = 264

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 230/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ ++ I  + ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGDRGIGDVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R  A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRLAA 264


>gi|150398394|ref|YP_001328861.1| cobyrinic acid ac-diamide synthase [Sinorhizobium medicae WSM419]
 gi|150029909|gb|ABR62026.1| Cobyrinic acid ac-diamide synthase [Sinorhizobium medicae WSM419]
          Length = 264

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/260 (75%), Positives = 228/260 (87%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K+RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+   R  SS
Sbjct: 5   KNRIITIANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIQRRARHLSS 64

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y+L++   +I +I   TA+PNLSI+PSTMDLLG+EM +  E DR+FRL KAL       +
Sbjct: 65  YELMMGTHSIAEIAQDTAVPNLSIVPSTMDLLGVEMEIAKESDRVFRLRKALGSAEALAY 124

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           SYI +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VRRTVN ALDIQ
Sbjct: 125 SYILVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRRTVNPALDIQ 184

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFDSRN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLKCAGS
Sbjct: 185 GIVLTMFDSRNNLAQQVVSDVRLHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGS 244

Query: 245 QAYLKLASELIQQERHRKEA 264
           QAYL+LASE+IQ+ER RK A
Sbjct: 245 QAYLQLASEVIQRERQRKAA 264


>gi|222150243|ref|YP_002551200.1| chromosome partitioning protein [Agrobacterium vitis S4]
 gi|221737225|gb|ACM38188.1| chromosome partitioning protein [Agrobacterium vitis S4]
          Length = 264

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/264 (73%), Positives = 231/264 (87%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +K+RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MPYEKNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDLLI   ++++ +I TA+PNLSI+PST+DLLG+EM +  + DR+FRL  AL  Q 
Sbjct: 61  KLSSYDLLIGSHSVSETVIDTAVPNLSIVPSTLDLLGLEMEIAQKADRVFRLKAALQSQD 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              +SY+ +DCPPSFNLLTMNAMAAA SILVPLQCEFFALEGLSQLLET+ +VRR VN  
Sbjct: 121 GLAYSYVLVDCPPSFNLLTMNAMAAAHSILVPLQCEFFALEGLSQLLETIGQVRRNVNPT 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFDSRN+L+QQVV+DVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDSRNNLAQQVVTDVRSHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER R+ A
Sbjct: 241 CAGSQAYLQLASEVIQRERQRRAA 264


>gi|307302550|ref|ZP_07582307.1| Cobyrinic acid ac-diamide synthase [Sinorhizobium meliloti BL225C]
 gi|307316119|ref|ZP_07595563.1| Cobyrinic acid ac-diamide synthase [Sinorhizobium meliloti AK83]
 gi|306897959|gb|EFN28701.1| Cobyrinic acid ac-diamide synthase [Sinorhizobium meliloti AK83]
 gi|306903220|gb|EFN33810.1| Cobyrinic acid ac-diamide synthase [Sinorhizobium meliloti BL225C]
          Length = 264

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 228/260 (87%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K+RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+   R  SS
Sbjct: 5   KNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIQRRARHLSS 64

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y+L++   +I QI   TA+PNL+I+PSTMDLLG+EM +  E DR+FRL KAL+      +
Sbjct: 65  YELMMGTHSIGQIAQDTAVPNLAIVPSTMDLLGVEMEISKESDRVFRLRKALASVDALAY 124

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           SY+ +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VR+TVN  LDIQ
Sbjct: 125 SYVLVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRQTVNPGLDIQ 184

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFDSRN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLKCAGS
Sbjct: 185 GIVLTMFDSRNNLAQQVVSDVRLHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGS 244

Query: 245 QAYLKLASELIQQERHRKEA 264
           QAYL+LASE+IQ+ER RK A
Sbjct: 245 QAYLQLASEVIQRERQRKAA 264


>gi|15967088|ref|NP_387441.1| chromosome partitioning protein ParA [Sinorhizobium meliloti 1021]
 gi|15076361|emb|CAC47914.1| Probable chromosome partitioning protein ParA [Sinorhizobium
           meliloti 1021]
          Length = 264

 Score =  404 bits (1038), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 227/260 (87%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K+RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+   R  SS
Sbjct: 5   KNRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIQRRARHLSS 64

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y+L++    I QI   TA+PNL+I+PSTMDLLG+EM +  E DR+FRL KAL+      +
Sbjct: 65  YELMMGTHAIGQIAQDTAVPNLAIVPSTMDLLGVEMEISKESDRVFRLRKALASVDALAY 124

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           SY+ +DCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV++VR+TVN  LDIQ
Sbjct: 125 SYVLVDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVDQVRQTVNPGLDIQ 184

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFDSRN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLKCAGS
Sbjct: 185 GIVLTMFDSRNNLAQQVVSDVRLHLGDKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGS 244

Query: 245 QAYLKLASELIQQERHRKEA 264
           QAYL+LASE+IQ+ER RK A
Sbjct: 245 QAYLQLASEVIQRERQRKAA 264


>gi|218463268|ref|ZP_03503359.1| Cobyrinic acid ac-diamide synthase [Rhizobium etli Kim 5]
          Length = 271

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/255 (74%), Positives = 225/255 (88%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  ++ RIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MAGERHRIITIANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDL++ E+ I+++ ++TA+PNL I+PSTMDLLGIEM +  + DR+F+L KALS   
Sbjct: 61  KLSSYDLMVGERGISEVTLETAVPNLFIVPSTMDLLGIEMEISQQSDRVFKLRKALSSAE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              FSYI LDCPPSFNLLTMNAMAAA S+LVPLQCEFFALEGLSQLLETV +VRRTVN  
Sbjct: 121 AMAFSYILLDCPPSFNLLTMNAMAAAHSVLVPLQCEFFALEGLSQLLETVSQVRRTVNPR 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVV+DVR +LG KVY+T+IPRN R+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVNDVRTHLGEKVYHTLIPRNARVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELI 255
           CAGSQAYL+LASE+I
Sbjct: 241 CAGSQAYLQLASEVI 255


>gi|163757462|ref|ZP_02164551.1| chromosome partitioning protein A [Hoeflea phototrophica DFL-43]
 gi|162284964|gb|EDQ35246.1| chromosome partitioning protein A [Hoeflea phototrophica DFL-43]
          Length = 264

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/264 (71%), Positives = 225/264 (85%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M   K+RIITIANQKGGVGKTTTAINL+TALAAIGE VL++D+DPQGNASTGLGI+  DR
Sbjct: 1   MPHAKNRIITIANQKGGVGKTTTAINLATALAAIGEEVLIVDIDPQGNASTGLGIDRRDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
             S+YDLL +  +++   I+TA+P+LSIIPSTMDLLG+EM + G  DR+FRL KAL    
Sbjct: 61  GVSAYDLLTQNASVSDTAIETAVPHLSIIPSTMDLLGVEMEIAGTPDRVFRLRKALQADD 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              +SY+ +DCPPS NLLTMNAMAAA SILVPLQCEFFALEGLSQLLETV +VR T+N  
Sbjct: 121 AKSYSYVLIDCPPSLNLLTMNAMAAAHSILVPLQCEFFALEGLSQLLETVGQVRDTLNPT 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI++TMFD+RN+L+ QVV DVR +LG KVY T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVMTMFDARNNLALQVVDDVRAHLGEKVYRTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER+RK A
Sbjct: 241 CAGSQAYLQLASEVIQRERNRKAA 264


>gi|325294199|ref|YP_004280063.1| chromosome partitioning protein [Agrobacterium sp. H13-3]
 gi|325062052|gb|ADY65743.1| chromosome partitioning protein [Agrobacterium sp. H13-3]
          Length = 264

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/264 (70%), Positives = 225/264 (85%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +K+RII +ANQKGGVGKTTTAINL+TALAAIGE VL+IDLDPQGNASTGLGI+  +R
Sbjct: 1   MTSEKNRIIAVANQKGGVGKTTTAINLATALAAIGERVLIIDLDPQGNASTGLGIDRKER 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDLL+ +  + ++ + TA+PNL I+PSTMDLLG EM +    +R+F L  A+  Q 
Sbjct: 61  KLSSYDLLVGDHTVAEVAVPTAVPNLDIVPSTMDLLGFEMQVANVANRVFLLRTAMETQE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
             D+SYI +DCPPSFNLLTMNAM AA S+LVPLQCEFFALEGLSQLL+TV ++R +VN  
Sbjct: 121 ARDYSYILVDCPPSFNLLTMNAMTAAHSVLVPLQCEFFALEGLSQLLDTVSQIRGSVNPQ 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVSDVRMHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER RK A
Sbjct: 241 CAGSQAYLQLASEVIQRERLRKAA 264


>gi|15890074|ref|NP_355755.1| chromosome partitioning protein [Agrobacterium tumefaciens str.
           C58]
 gi|15158059|gb|AAK88540.1| Chromosome partitioning protein [Agrobacterium tumefaciens str.
           C58]
          Length = 264

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/264 (70%), Positives = 223/264 (84%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +K+RII +ANQKGGVGKTTTAINL+TALAAIGE VL+IDLDPQGNASTGLGI+  +R
Sbjct: 1   MTFEKNRIIAVANQKGGVGKTTTAINLATALAAIGERVLIIDLDPQGNASTGLGIDRKER 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           K SSYDLL+ E  I ++ + TA+PNL I+PSTMDLLG EM +    +R+F L  A+    
Sbjct: 61  KLSSYDLLVGEHGIAEVAVPTAVPNLDIVPSTMDLLGFEMQVANVANRVFLLRAAMETPE 120

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              +SYI +DCPPSFNLLTMNAM AA S+LVPLQCEFFALEGLSQLL+TV ++R +VN  
Sbjct: 121 ARGYSYILVDCPPSFNLLTMNAMTAAHSVLVPLQCEFFALEGLSQLLDTVSQIRGSVNPQ 180

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDIQGI+LTMFD+RN+L+QQVVSDVR +LG KVY+T+IPRNVR+SEAPSYGKPAI+YDLK
Sbjct: 181 LDIQGIVLTMFDARNNLAQQVVSDVRSHLGEKVYHTLIPRNVRVSEAPSYGKPAILYDLK 240

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYL+LASE+IQ+ER RK A
Sbjct: 241 CAGSQAYLQLASEVIQRERLRKAA 264


>gi|110635797|ref|YP_676005.1| chromosome segregation ATPase [Mesorhizobium sp. BNC1]
 gi|110286781|gb|ABG64840.1| chromosome segregation ATPase [Chelativorans sp. BNC1]
          Length = 264

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/262 (68%), Positives = 220/262 (83%), Gaps = 1/262 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIIT+ANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLG+E   R  S
Sbjct: 3   KPSRIITVANQKGGVGKTTTAINLATALAAIGERVLIVDLDPQGNASTGLGVERKIRNIS 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTS 122
           SYD+LI   +I+   ++TA+P L+I+PST+DLLGIEM + G +DR+ +L +AL       
Sbjct: 63  SYDVLIGASDIDNAAMETAVPGLAIVPSTLDLLGIEMEISGAQDRVLKLRRALRETPSKK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            FSY+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLLETVE++R ++N AL 
Sbjct: 123 GFSYVLIDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLETVEQIRGSINPALT 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTMFD RN+L+ QVV DVR ++G  VY TVIPRNVR+SEAPSYGKPAI+YDLKC+
Sbjct: 183 IQGIVLTMFDGRNNLANQVVEDVRAHMGETVYETVIPRNVRVSEAPSYGKPAILYDLKCS 242

Query: 243 GSQAYLKLASELIQQERHRKEA 264
           GSQAYL+LASE+I++ER  + A
Sbjct: 243 GSQAYLQLASEVIRRERRLRAA 264


>gi|256060023|ref|ZP_05450205.1| hypothetical protein Bneo5_06661 [Brucella neotomae 5K33]
 gi|261324000|ref|ZP_05963197.1| cobyrinic acid ac-diamide synthase [Brucella neotomae 5K33]
 gi|261299980|gb|EEY03477.1| cobyrinic acid ac-diamide synthase [Brucella neotomae 5K33]
          Length = 265

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/263 (68%), Positives = 220/263 (83%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 3   KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L++  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 63  SYDVLMQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 122

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N  L
Sbjct: 123 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTINPEL 182

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 183 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 242

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 243 AGSQAYLQLASEVIQRERQLQAA 265


>gi|225626438|ref|ZP_03784477.1| chromosome partitioning protein PARA [Brucella ceti str. Cudo]
 gi|225618095|gb|EEH15138.1| chromosome partitioning protein PARA [Brucella ceti str. Cudo]
          Length = 303

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/263 (68%), Positives = 219/263 (83%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 41  KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 100

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 101 SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 160

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N  L
Sbjct: 161 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTINPEL 220

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 221 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 280

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 281 AGSQAYLQLASEVIQRERQLQAA 303


>gi|23502907|ref|NP_699034.1| chromosome partitioning protein ParA [Brucella suis 1330]
 gi|148560162|ref|YP_001259864.1| chromosome partitioning protein ParA [Brucella ovis ATCC 25840]
 gi|161619973|ref|YP_001593860.1| hypothetical protein BCAN_A2105 [Brucella canis ATCC 23365]
 gi|254700689|ref|ZP_05162517.1| hypothetical protein Bsuib55_07512 [Brucella suis bv. 5 str. 513]
 gi|254705060|ref|ZP_05166888.1| hypothetical protein Bsuib36_14289 [Brucella suis bv. 3 str. 686]
 gi|254709036|ref|ZP_05170847.1| hypothetical protein BpinB_01982 [Brucella pinnipedialis B2/94]
 gi|254713538|ref|ZP_05175349.1| hypothetical protein BcetM6_09319 [Brucella ceti M644/93/1]
 gi|254716107|ref|ZP_05177918.1| hypothetical protein BcetM_06686 [Brucella ceti M13/05/1]
 gi|254718101|ref|ZP_05179912.1| hypothetical protein Bru83_00894 [Brucella sp. 83/13]
 gi|256030561|ref|ZP_05444175.1| hypothetical protein BpinM2_07907 [Brucella pinnipedialis
           M292/94/1]
 gi|256158557|ref|ZP_05456447.1| hypothetical protein BcetM4_06826 [Brucella ceti M490/95/1]
 gi|256253966|ref|ZP_05459502.1| hypothetical protein BcetB_06656 [Brucella ceti B1/94]
 gi|256370457|ref|YP_003107968.1| chromosome partitioning protein ParA [Brucella microti CCM 4915]
 gi|260169466|ref|ZP_05756277.1| chromosome partitioning protein ParA [Brucella sp. F5/99]
 gi|260567471|ref|ZP_05837941.1| NifH/frxC family protein [Brucella suis bv. 4 str. 40]
 gi|261217878|ref|ZP_05932159.1| cobyrinic acid ac-diamide synthase [Brucella ceti M13/05/1]
 gi|261221108|ref|ZP_05935389.1| cobyrinic acid ac-diamide synthase [Brucella ceti B1/94]
 gi|261316535|ref|ZP_05955732.1| cobyrinic acid ac-diamide synthase [Brucella pinnipedialis B2/94]
 gi|261321272|ref|ZP_05960469.1| cobyrinic acid ac-diamide synthase [Brucella ceti M644/93/1]
 gi|261751198|ref|ZP_05994907.1| cobyrinic acid ac-diamide synthase [Brucella suis bv. 5 str. 513]
 gi|261755763|ref|ZP_05999472.1| cobyrinic acid ac-diamide synthase [Brucella suis bv. 3 str. 686]
 gi|261758993|ref|ZP_06002702.1| NifH/frxC family protein [Brucella sp. F5/99]
 gi|265983054|ref|ZP_06095789.1| cobyrinic acid ac-diamide synthase [Brucella sp. 83/13]
 gi|265987609|ref|ZP_06100166.1| cobyrinic acid ac-diamide synthase [Brucella pinnipedialis
           M292/94/1]
 gi|265997069|ref|ZP_06109626.1| cobyrinic acid ac-diamide synthase [Brucella ceti M490/95/1]
 gi|306839726|ref|ZP_07472528.1| chromosome partitioning protein PARA [Brucella sp. NF 2653]
 gi|306842826|ref|ZP_07475466.1| chromosome partitioning protein PARA [Brucella sp. BO2]
 gi|306843475|ref|ZP_07476076.1| chromosome partitioning protein PARA [Brucella sp. BO1]
 gi|23348938|gb|AAN30949.1| chromosome partitioning protein ParA [Brucella suis 1330]
 gi|148371419|gb|ABQ61398.1| chromosome partitioning protein ParA [Brucella ovis ATCC 25840]
 gi|161336784|gb|ABX63089.1| Hypothetical protein BCAN_A2105 [Brucella canis ATCC 23365]
 gi|256000620|gb|ACU49019.1| chromosome partitioning protein ParA [Brucella microti CCM 4915]
 gi|260156989|gb|EEW92069.1| NifH/frxC family protein [Brucella suis bv. 4 str. 40]
 gi|260919692|gb|EEX86345.1| cobyrinic acid ac-diamide synthase [Brucella ceti B1/94]
 gi|260922967|gb|EEX89535.1| cobyrinic acid ac-diamide synthase [Brucella ceti M13/05/1]
 gi|261293962|gb|EEX97458.1| cobyrinic acid ac-diamide synthase [Brucella ceti M644/93/1]
 gi|261295758|gb|EEX99254.1| cobyrinic acid ac-diamide synthase [Brucella pinnipedialis B2/94]
 gi|261738977|gb|EEY26973.1| NifH/frxC family protein [Brucella sp. F5/99]
 gi|261740951|gb|EEY28877.1| cobyrinic acid ac-diamide synthase [Brucella suis bv. 5 str. 513]
 gi|261745516|gb|EEY33442.1| cobyrinic acid ac-diamide synthase [Brucella suis bv. 3 str. 686]
 gi|262551537|gb|EEZ07527.1| cobyrinic acid ac-diamide synthase [Brucella ceti M490/95/1]
 gi|264659806|gb|EEZ30067.1| cobyrinic acid ac-diamide synthase [Brucella pinnipedialis
           M292/94/1]
 gi|264661646|gb|EEZ31907.1| cobyrinic acid ac-diamide synthase [Brucella sp. 83/13]
 gi|306276166|gb|EFM57866.1| chromosome partitioning protein PARA [Brucella sp. BO1]
 gi|306287020|gb|EFM58531.1| chromosome partitioning protein PARA [Brucella sp. BO2]
 gi|306405186|gb|EFM61463.1| chromosome partitioning protein PARA [Brucella sp. NF 2653]
          Length = 265

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/263 (68%), Positives = 219/263 (83%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 3   KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 63  SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 122

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N  L
Sbjct: 123 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTINPEL 182

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 183 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 242

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 243 AGSQAYLQLASEVIQRERQLQAA 265


>gi|239833100|ref|ZP_04681429.1| cobyrinic acid ac-diamide synthase [Ochrobactrum intermedium LMG
           3301]
 gi|239825367|gb|EEQ96935.1| cobyrinic acid ac-diamide synthase [Ochrobactrum intermedium LMG
           3301]
          Length = 266

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/266 (68%), Positives = 217/266 (81%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  +R
Sbjct: 1   MMNKMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRRNR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ- 119
             SSYD+L +E ++    + T +PNL I+PST+DLLGIEM +    DR  RL  AL    
Sbjct: 61  PLSSYDVLTQEASVPDAAMPTDVPNLHIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDS 120

Query: 120 -LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
            +   FSY+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N
Sbjct: 121 AVAERFSYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTIN 180

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YD
Sbjct: 181 PELSIQGIVLTMFDSRNNLAAQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYD 240

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           LKCAGSQAYL+LASE+IQ+ER  + A
Sbjct: 241 LKCAGSQAYLQLASEVIQRERQLQAA 266


>gi|294851288|ref|ZP_06791961.1| chromosome partitioning protein [Brucella sp. NVSL 07-0026]
 gi|294819877|gb|EFG36876.1| chromosome partitioning protein [Brucella sp. NVSL 07-0026]
          Length = 303

 Score =  374 bits (961), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/261 (68%), Positives = 218/261 (83%), Gaps = 2/261 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  SSY
Sbjct: 43  SRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLSSY 102

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LTSD 123
           D+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++  
Sbjct: 103 DVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVSER 162

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N  L I
Sbjct: 163 FTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTINPELSI 222

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKCAG
Sbjct: 223 QGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKCAG 282

Query: 244 SQAYLKLASELIQQERHRKEA 264
           SQAYL+LASE+IQ+ER  + A
Sbjct: 283 SQAYLQLASEVIQRERQLQAA 303


>gi|17986293|ref|NP_538927.1| chromosome partitioning protein PARA [Brucella melitensis bv. 1
           str. 16M]
 gi|17981875|gb|AAL51191.1| chromosome partitioning protein para [Brucella melitensis bv. 1
           str. 16M]
          Length = 278

 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 218/263 (82%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 16  KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 75

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 76  SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 135

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGL QLL+TV++VR T+N  L
Sbjct: 136 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLGQLLQTVDQVRSTINPEL 195

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 196 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 255

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 256 AGSQAYLQLASEVIQRERQLQAA 278


>gi|260467202|ref|ZP_05813379.1| Cobyrinic acid ac-diamide synthase [Mesorhizobium opportunistum
           WSM2075]
 gi|259029055|gb|EEW30354.1| Cobyrinic acid ac-diamide synthase [Mesorhizobium opportunistum
           WSM2075]
          Length = 273

 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/266 (66%), Positives = 220/266 (82%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M +   RIIT+ANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 8   MMKNGPRIITVANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIDRKDR 67

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SV 118
             SSYD+L  E  + +  I TA+P LSI+PST+DLLGIEM +    DR+ +L  AL  + 
Sbjct: 68  TVSSYDVLTGELELEEAAIPTAVPGLSIVPSTLDLLGIEMEIASAPDRVLKLRNALRAAT 127

Query: 119 QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
           +  + F Y+ +DCPPS NLLT+N+MAAADS+LVPLQCEFFALEGLSQLLETVE+VRR++N
Sbjct: 128 ERGAPFGYVLIDCPPSLNLLTLNSMAAADSVLVPLQCEFFALEGLSQLLETVEQVRRSIN 187

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L IQGI+LTM+D RN+L+ QVV DVR+++G KVY T+IPRNVR+SEAPSYGKPAI+YD
Sbjct: 188 PDLTIQGIVLTMYDGRNNLANQVVQDVRQHMGDKVYETIIPRNVRVSEAPSYGKPAILYD 247

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           LKC+GSQAYL+LASE+I++ER  + A
Sbjct: 248 LKCSGSQAYLQLASEVIRRERKLRAA 273


>gi|163844077|ref|YP_001628481.1| hypothetical protein BSUIS_A1900 [Brucella suis ATCC 23445]
 gi|163674800|gb|ABY38911.1| Hypothetical protein BSUIS_A1900 [Brucella suis ATCC 23445]
          Length = 262

 Score =  374 bits (959), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/261 (68%), Positives = 218/261 (83%), Gaps = 2/261 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  SSY
Sbjct: 2   SRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLSSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LTSD 123
           D+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++  
Sbjct: 62  DVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVSER 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR T+N  L I
Sbjct: 122 FTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSTINPELSI 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKCAG
Sbjct: 182 QGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKCAG 241

Query: 244 SQAYLKLASELIQQERHRKEA 264
           SQAYL+LASE+IQ+ER  + A
Sbjct: 242 SQAYLQLASEVIQRERQLQAA 262


>gi|225853490|ref|YP_002733723.1| hypothetical protein BMEA_A2120 [Brucella melitensis ATCC 23457]
 gi|254690191|ref|ZP_05153445.1| chromosome partitioning protein PARA [Brucella abortus bv. 6 str.
           870]
 gi|254694681|ref|ZP_05156509.1| chromosome partitioning protein PARA [Brucella abortus bv. 3 str.
           Tulya]
 gi|256045661|ref|ZP_05448539.1| chromosome partitioning protein PARA [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256112383|ref|ZP_05453304.1| chromosome partitioning protein PARA [Brucella melitensis bv. 3
           str. Ether]
 gi|256258445|ref|ZP_05463981.1| chromosome partitioning protein PARA [Brucella abortus bv. 9 str.
           C68]
 gi|256263030|ref|ZP_05465562.1| NifH/frxC family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|260562963|ref|ZP_05833449.1| NifH/frxC family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260755732|ref|ZP_05868080.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 6 str.
           870]
 gi|260884758|ref|ZP_05896372.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 9 str.
           C68]
 gi|261215009|ref|ZP_05929290.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 3 str.
           Tulya]
 gi|265992083|ref|ZP_06104640.1| cobyrinic acid ac-diamide synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993818|ref|ZP_06106375.1| cobyrinic acid ac-diamide synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297247287|ref|ZP_06931005.1| chromosome partitioning protein [Brucella abortus bv. 5 str. B3196]
 gi|225641855|gb|ACO01769.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|260152979|gb|EEW88071.1| NifH/frxC family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260675840|gb|EEX62661.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 6 str.
           870]
 gi|260874286|gb|EEX81355.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 9 str.
           C68]
 gi|260916616|gb|EEX83477.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 3 str.
           Tulya]
 gi|262764799|gb|EEZ10720.1| cobyrinic acid ac-diamide synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003149|gb|EEZ15442.1| cobyrinic acid ac-diamide synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092903|gb|EEZ17078.1| NifH/frxC family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|297174456|gb|EFH33803.1| chromosome partitioning protein [Brucella abortus bv. 5 str. B3196]
 gi|326410054|gb|ADZ67119.1| chromosome partitioning protein PARA [Brucella melitensis M28]
 gi|326539771|gb|ADZ87986.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 265

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 218/263 (82%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 3   KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 63  SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 122

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGL QLL+TV++VR T+N  L
Sbjct: 123 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLGQLLQTVDQVRSTINPEL 182

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 183 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 242

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 243 AGSQAYLQLASEVIQRERQLQAA 265


>gi|319780615|ref|YP_004140091.1| chromosome partitioning protein, ParA [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166503|gb|ADV10041.1| chromosome partitioning protein, ParA [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 266

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 218/266 (81%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M +   RIIT+ANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MMKNGPRIITVANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIDRKDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SV 118
             SSYD+L  E  +    I TA+P LSI+PST+DLLGIEM +    DR+ +L  AL  + 
Sbjct: 61  TVSSYDVLTGELELEAAAIPTAVPGLSIVPSTLDLLGIEMEIASAPDRVLKLRNALRAAT 120

Query: 119 QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
           +  + F Y+ +DCPPS NLLT+N+MAAADS+LVPLQCEFFALEGLSQLLETVE+VRR++N
Sbjct: 121 ERGAPFGYVLIDCPPSLNLLTLNSMAAADSVLVPLQCEFFALEGLSQLLETVEQVRRSIN 180

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L IQGI+LTM+D RN+L+ QVV DVR ++G KVY TVIPRNVR+SEAPSYGKPAI+YD
Sbjct: 181 PDLTIQGIVLTMYDGRNNLANQVVQDVRAHMGDKVYETVIPRNVRVSEAPSYGKPAILYD 240

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           LKC+GSQAYL+LASE+I++ER  + A
Sbjct: 241 LKCSGSQAYLQLASEVIRRERKLRAA 266


>gi|237816409|ref|ZP_04595402.1| chromosome partitioning protein PARA [Brucella abortus str. 2308 A]
 gi|237788476|gb|EEP62691.1| chromosome partitioning protein PARA [Brucella abortus str. 2308 A]
          Length = 303

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 217/263 (82%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 41  KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 100

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 101 SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 160

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGL QLL+TV +VR T+N  L
Sbjct: 161 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLGQLLQTVNQVRSTINPEL 220

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 221 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 280

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 281 AGSQAYLQLASEVIQRERQLQAA 303


>gi|62290903|ref|YP_222696.1| chromosome partitioning protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700814|ref|YP_415388.1| NifH/FrxC family ATPase [Brucella melitensis biovar Abortus 2308]
 gi|189025116|ref|YP_001935884.1| NifH/frxC family protein [Brucella abortus S19]
 gi|254696308|ref|ZP_05158136.1| NifH/frxC family protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731224|ref|ZP_05189802.1| NifH/frxC family protein [Brucella abortus bv. 4 str. 292]
 gi|260546164|ref|ZP_05821904.1| NifH/frxC family protein [Brucella abortus NCTC 8038]
 gi|260758956|ref|ZP_05871304.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 4 str.
           292]
 gi|260760679|ref|ZP_05873022.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|62197035|gb|AAX75335.1| ParA, chromosome partitioning protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82616915|emb|CAJ12016.1| NifH/frxC family:ATPase, ParA type [Brucella melitensis biovar
           Abortus 2308]
 gi|189020688|gb|ACD73410.1| NifH/frxC family protein [Brucella abortus S19]
 gi|260096271|gb|EEW80147.1| NifH/frxC family protein [Brucella abortus NCTC 8038]
 gi|260669274|gb|EEX56214.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 4 str.
           292]
 gi|260671111|gb|EEX57932.1| cobyrinic acid ac-diamide synthase [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 265

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 217/263 (82%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+ ++R  S
Sbjct: 3   KMSRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRHNRPLS 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LT 121
           SYD+L +  ++ +  +QT +PNL I+PST+DLLGIEM +    DR  RL  AL     ++
Sbjct: 63  SYDVLTQASSVPEAAMQTDVPNLFIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSGVS 122

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGL QLL+TV +VR T+N  L
Sbjct: 123 ERFTYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLGQLLQTVNQVRSTINPEL 182

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKC
Sbjct: 183 SIQGIVLTMFDSRNNLATQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKC 242

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
           AGSQAYL+LASE+IQ+ER  + A
Sbjct: 243 AGSQAYLQLASEVIQRERQLQAA 265


>gi|153008197|ref|YP_001369412.1| cobyrinic acid ac-diamide synthase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560085|gb|ABS13583.1| Cobyrinic acid ac-diamide synthase [Ochrobactrum anthropi ATCC
           49188]
          Length = 262

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/261 (68%), Positives = 217/261 (83%), Gaps = 2/261 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRIITIANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  +R  SSY
Sbjct: 2   SRIITIANQKGGVGKTTTAINLATALAAIGETVLIVDLDPQGNASTGLGIDRRNRPLSSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--QLTSD 123
           D+L +E ++    + T +PNL I+PST+DLLGIEM +    DR  RL  AL     ++  
Sbjct: 62  DVLTQESSVPDAAMPTDVPNLHIVPSTLDLLGIEMEIAQSADRTRRLRDALRFDSSVSER 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           FSY+ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TV++VR ++N+ L I
Sbjct: 122 FSYVLVDCPPSLNLLTLNAMAAADSVLVPLQCEFFALEGLSQLLQTVDQVRSSINAELSI 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QGI+LTMFDSRN+L+ QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPAI+YDLKCAG
Sbjct: 182 QGIVLTMFDSRNNLAAQVVDDVRAFMGEKVYRTVIPRNVRVSEAPSHGKPAILYDLKCAG 241

Query: 244 SQAYLKLASELIQQERHRKEA 264
           SQAYL+LASE+IQ+ER  + A
Sbjct: 242 SQAYLQLASEVIQRERQLQAA 262


>gi|163869376|ref|YP_001610632.1| chromosome partitioning protein ParA [Bartonella tribocorum CIP
           105476]
 gi|161019079|emb|CAK02637.1| chromosome partitioning protein ParA [Bartonella tribocorum CIP
           105476]
          Length = 265

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/263 (66%), Positives = 219/263 (83%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTTAINL+TALAAIGENVL++D+DPQGNASTGLGI+   R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTAINLATALAAIGENVLIMDVDPQGNASTGLGIDRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTS 122
           YD+L+   +I Q  ++TA+PNL I+PST+DLLG+EM +   +DR+ RL KAL    ++  
Sbjct: 63  YDVLVSGVSITQAALKTAVPNLHIVPSTLDLLGVEMEISSSQDRIQRLRKALYDDPEMEK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AADS+LVP+QCEF ALEGLSQLLETV++VR  +N +L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAADSVLVPMQCEFLALEGLSQLLETVKQVRSVLNPSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGDKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEMIQREKQARAAA 265


>gi|218516417|ref|ZP_03513257.1| chromosome partitioning protein A [Rhizobium etli 8C-3]
          Length = 247

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 206/235 (87%)

Query: 30  ALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSII 89
           ALAAIGE VL++DLDPQGNASTGLGI+  DRK SSYDL++ E+ I+++ ++TA+PNL I+
Sbjct: 13  ALAAIGERVLIVDLDPQGNASTGLGIDRRDRKLSSYDLMVGERGISEVTLETAVPNLFIV 72

Query: 90  PSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSI 149
           PSTMDLLGIEM +  + DR+F+L KALS      FSYI LDCPPSFNLLTMNAMAAA S+
Sbjct: 73  PSTMDLLGIEMEISQQSDRVFKLRKALSTPEAMGFSYILLDCPPSFNLLTMNAMAAAHSV 132

Query: 150 LVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNL 209
           LVPLQCEFFALEGLSQLLETV +VRRTVN  LDIQGI+LTMFD+RN+L+QQVV+DVR +L
Sbjct: 133 LVPLQCEFFALEGLSQLLETVSQVRRTVNPRLDIQGIVLTMFDARNNLAQQVVNDVRTHL 192

Query: 210 GGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEA 264
           G KVY+T+IPRNVR+SEAPSYGKPAI+YDLKCAGSQAYL+LASE+IQ+ER R  A
Sbjct: 193 GEKVYHTLIPRNVRVSEAPSYGKPAILYDLKCAGSQAYLQLASEVIQRERQRLAA 247


>gi|49476315|ref|YP_034356.1| chromosome partitioning protein parA [Bartonella henselae str.
           Houston-1]
 gi|49239123|emb|CAF28427.1| Chromosome partitioning protein parA [Bartonella henselae str.
           Houston-1]
          Length = 265

 Score =  367 bits (943), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/261 (66%), Positives = 218/261 (83%), Gaps = 2/261 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINL+TALAAIGENVL++D+DPQGNASTGLGI+   R  SSYD
Sbjct: 5   RIIAIANQKGGVGKTTTAINLATALAAIGENVLIMDIDPQGNASTGLGIDRNSRPLSSYD 64

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           ++I   ++ +  ++TA+PNLSI+PST+DLLG+EM +   +DR+ RL KAL    ++   F
Sbjct: 65  VMISGISVTKAALKTAVPNLSIVPSTLDLLGVEMEIASSQDRIQRLRKALYDDPKMAKKF 124

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           SYI +DCPPS NLLT+NAM AADS+LVP+QCEF ALEGLSQLLETV++V+  +N +L+IQ
Sbjct: 125 SYILIDCPPSLNLLTLNAMGAADSVLVPMQCEFLALEGLSQLLETVKQVQSVLNPSLEIQ 184

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCAGS
Sbjct: 185 GIVLTMYDGRNNLSNQVVEDVRSFMGDKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCAGS 244

Query: 245 QAYLKLASELIQQERHRKEAA 265
           QAYL+LASE+IQ+E+  + AA
Sbjct: 245 QAYLRLASEVIQREKQAQAAA 265


>gi|240851400|ref|YP_002972803.1| chromosome partitioning protein ParA2 [Bartonella grahamii as4aup]
 gi|240268523|gb|ACS52111.1| chromosome partitioning protein ParA2 [Bartonella grahamii as4aup]
          Length = 265

 Score =  367 bits (943), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 220/263 (83%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTTAINL+TALAAIGENVL++D+DPQGNASTGLGI+  +R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTAINLATALAAIGENVLIMDVDPQGNASTGLGIDRNNRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTS 122
           YD+L+   +I Q  ++TA+PNL I+PST+DLLG+EM +   +DR+ RL KAL    ++  
Sbjct: 63  YDVLVSGISITQAALKTAVPNLYIVPSTLDLLGVEMEISSSQDRIQRLRKALYDDPEMEK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AA+S+LVP+QCEF ALEGLSQLLETV++VR  +N +L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAANSVLVPMQCEFLALEGLSQLLETVKQVRSVLNPSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGDKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEMIQREKQARAAA 265


>gi|13473773|ref|NP_105341.1| chromosome partitioning protein, ParA [Mesorhizobium loti
           MAFF303099]
 gi|14024524|dbj|BAB51127.1| chromosome partitioning protein; ParA [Mesorhizobium loti
           MAFF303099]
          Length = 266

 Score =  367 bits (942), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 216/266 (81%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M +   RIIT+ANQKGGVGKTTTAINL+TALAAIGE VL++DLDPQGNASTGLGI+  DR
Sbjct: 1   MLKNGPRIITVANQKGGVGKTTTAINLATALAAIGEKVLIVDLDPQGNASTGLGIDRKDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
             SSYD+L  E  +    I TA+P LSI+PST+DLLGIEM +    DR+ RL  AL    
Sbjct: 61  TVSSYDVLTGELELEAAAIPTAVPGLSIVPSTLDLLGIEMEIASAPDRVLRLRNALRAAS 120

Query: 121 TS--DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
                F Y+ +DCPPS NLLT+N+MAAADS+LVPLQCEFFALEGLSQLLETVE+VRR++N
Sbjct: 121 ARSAGFGYVLIDCPPSLNLLTLNSMAAADSVLVPLQCEFFALEGLSQLLETVEQVRRSIN 180

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L IQGI+LTM+D RN+L+ QVV DVR+++G KVY T+IPRNVR+SEAPSYGKPAI+YD
Sbjct: 181 PDLTIQGIVLTMYDGRNNLANQVVQDVREHMGDKVYETIIPRNVRVSEAPSYGKPAILYD 240

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           LKC+GSQAYL+LASE+I++ER  + A
Sbjct: 241 LKCSGSQAYLQLASEVIRRERKLRAA 266


>gi|296445004|ref|ZP_06886965.1| Cobyrinic acid ac-diamide synthase [Methylosinus trichosporium
           OB3b]
 gi|296257425|gb|EFH04491.1| Cobyrinic acid ac-diamide synthase [Methylosinus trichosporium
           OB3b]
          Length = 272

 Score =  367 bits (941), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 169/267 (63%), Positives = 222/267 (83%), Gaps = 7/267 (2%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RI+ +ANQKGGVGKTTTAINL TALAA+GE VL+IDLDPQGNASTGLG++   RK S+
Sbjct: 6   RPRILVMANQKGGVGKTTTAINLGTALAAVGETVLVIDLDPQGNASTGLGVDRKARKIST 65

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD- 123
           YD+L+ E ++   ++ TA+P LSI PST+DLLG+E+ + G+KDR FRL +A++  + ++ 
Sbjct: 66  YDVLLGESSLADAIVATAVPRLSIAPSTLDLLGVELQIAGDKDRAFRLKRAVAELMAAER 125

Query: 124 ------FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
                 F+Y+ +DCPPS NLLT+NA+A+ADS++VPLQCEFFALEGLSQLL TV++VR+T+
Sbjct: 126 HEQIPAFTYVLVDCPPSLNLLTINALASADSVVVPLQCEFFALEGLSQLLSTVDQVRKTL 185

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           NS L I GI+LTMFD RN+L+ QVV+DVR+ +G KVY TVIPRNVR+SEAPSYGKP ++Y
Sbjct: 186 NSRLTIHGIVLTMFDPRNNLATQVVADVRRFMGDKVYETVIPRNVRVSEAPSYGKPVLLY 245

Query: 238 DLKCAGSQAYLKLASELIQQERHRKEA 264
           DLKC+GSQAYLKLA+E+IQ+E+  + A
Sbjct: 246 DLKCSGSQAYLKLATEVIQREKQLRAA 272


>gi|75674294|ref|YP_316715.1| cobyrinic acid a,c-diamide synthase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419164|gb|ABA03363.1| chromosome segregation ATPase [Nitrobacter winogradskyi Nb-255]
          Length = 289

 Score =  367 bits (941), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 175/266 (65%), Positives = 217/266 (81%), Gaps = 5/266 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  RII++ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR  S
Sbjct: 23  RHPRIISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVS 82

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV----- 118
           +YD+LI E  +   ++ TA+P L I  STMDL G+E+ LG  KDR FRL  A++      
Sbjct: 83  TYDVLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGAAKDRAFRLRDAITALNGNA 142

Query: 119 QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
              +D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+N
Sbjct: 143 AYAADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLN 202

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YD
Sbjct: 203 PNLSIHGIVLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGKPVLVYD 262

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           LKC+GS+AYLKLA+E+IQ+ER  + A
Sbjct: 263 LKCSGSEAYLKLATEVIQRERELRMA 288


>gi|85714098|ref|ZP_01045087.1| cobyrinic acid a,c-diamide synthase [Nitrobacter sp. Nb-311A]
 gi|85699224|gb|EAQ37092.1| cobyrinic acid a,c-diamide synthase [Nitrobacter sp. Nb-311A]
          Length = 285

 Score =  366 bits (939), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/261 (67%), Positives = 216/261 (82%), Gaps = 5/261 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  RII++ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR  S
Sbjct: 19  RHPRIISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVS 78

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-----SV 118
           +YD+LI E  +   ++ TA+P L I  STMDL G+E+ LG  KDR FRL  A+     + 
Sbjct: 79  TYDVLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGATKDRAFRLRDAIIALNGNA 138

Query: 119 QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
             T+D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+N
Sbjct: 139 ADTADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLN 198

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YD
Sbjct: 199 PNLSIHGIVLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGKPVLVYD 258

Query: 239 LKCAGSQAYLKLASELIQQER 259
           LKC+GS+AYLKLA+E+IQ+ER
Sbjct: 259 LKCSGSEAYLKLATEVIQRER 279


>gi|319409462|emb|CBI83111.1| chromosome partitioning protein ParA [Bartonella schoenbuchensis
           R1]
          Length = 265

 Score =  366 bits (939), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 218/263 (82%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTTAINL+TALAAIGEN+L++D+DPQGNASTGLGI+   R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTAINLATALAAIGENILIMDIDPQGNASTGLGIDRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS--VQLTS 122
           YD+LI   ++    ++T +PNL I+PST+DLLG+EM +   +DR+ RL KAL     ++ 
Sbjct: 63  YDVLISGISVVDAALKTVVPNLHIVPSTLDLLGVEMEIASSQDRIQRLRKALCDDQMVSQ 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            FSYI +DCPPS NLLT+NAM AADS+LVP+QCEF ALEGLSQLLETV++VR  +N +L+
Sbjct: 123 KFSYILIDCPPSLNLLTLNAMGAADSVLVPMQCEFLALEGLSQLLETVKQVRYALNPSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPA++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNVRVSEAPSFGKPALLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LA+E+IQ+E+  K AA
Sbjct: 243 GSQAYLRLATEIIQREKQAKTAA 265


>gi|254472198|ref|ZP_05085598.1| chromosome partitioning protein, ParA [Pseudovibrio sp. JE062]
 gi|211958481|gb|EEA93681.1| chromosome partitioning protein, ParA [Pseudovibrio sp. JE062]
          Length = 275

 Score =  365 bits (938), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/269 (64%), Positives = 217/269 (80%), Gaps = 7/269 (2%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  R++TIANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+  DR+YS
Sbjct: 6   QSPRVLTIANQKGGVGKTTTAINLGTALAAIGERVLIIDLDPQGNASTGLGIDRVDREYS 65

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS------ 117
           +YD+L  +  + Q +++TA+P L I PSTMDLLG+E+ +    DR FRL  A+S      
Sbjct: 66  TYDVLSGDSTLEQTVLETAVPRLWIAPSTMDLLGVELEISSAPDRTFRLRNAISGMAQAA 125

Query: 118 -VQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
            +     +SY+ +DCPPS NLLT+NA+AA+ SILVPLQCEFFALEGLSQLL TVE+V+++
Sbjct: 126 EMGRAQGYSYVLVDCPPSLNLLTINALAASHSILVPLQCEFFALEGLSQLLSTVEQVKQS 185

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L I GI+LTM+DSRN+LS QVV DVR+ +G  VY TVIPRNVR+SEAPSYGKPA++
Sbjct: 186 LNPELSIHGIVLTMYDSRNNLSSQVVQDVRETMGDAVYETVIPRNVRVSEAPSYGKPALL 245

Query: 237 YDLKCAGSQAYLKLASELIQQERHRKEAA 265
           YDLKC+GSQAYL+LASE+IQ+ER  + AA
Sbjct: 246 YDLKCSGSQAYLRLASEIIQRERDMRMAA 274


>gi|90421812|ref|YP_530182.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           BisB18]
 gi|90103826|gb|ABD85863.1| chromosome segregation ATPase [Rhodopseudomonas palustris BisB18]
          Length = 284

 Score =  365 bits (937), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 175/265 (66%), Positives = 217/265 (81%), Gaps = 5/265 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K RI+ +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  +R  S+
Sbjct: 19  KPRILALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRNCST 78

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-----VQ 119
           YD+LI E  +   ++ TA+P L I PSTMDL G+E+ LG  +DR FRL  A++     + 
Sbjct: 79  YDVLIGEAPLRDAVVPTAVPRLHIAPSTMDLSGLELELGATRDRAFRLRDAIAALNDNIA 138

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
              D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+N 
Sbjct: 139 PPLDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNP 198

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDL
Sbjct: 199 NLSIHGIVLTMFDSRNNLSNQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDL 258

Query: 240 KCAGSQAYLKLASELIQQERHRKEA 264
           KCAGS+AYLKLA+E+IQ+ER  + A
Sbjct: 259 KCAGSEAYLKLATEVIQRERELRTA 283


>gi|115522414|ref|YP_779325.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           BisA53]
 gi|115516361|gb|ABJ04345.1| chromosome segregation ATPase [Rhodopseudomonas palustris BisA53]
          Length = 283

 Score =  364 bits (935), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 172/258 (66%), Positives = 217/258 (84%), Gaps = 5/258 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  +R  S+YD
Sbjct: 20  RIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRNCSTYD 79

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV-----QLT 121
           +LI E ++ + ++ TA+P L+I PSTMDL G+E+ LG  +DR +RL  A++      +  
Sbjct: 80  VLIGEASLREAVVATAVPRLAIAPSTMDLSGLELELGATRDRAYRLRDAIAALNHNAEPK 139

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           +D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+N  L
Sbjct: 140 ADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNL 199

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDLKC
Sbjct: 200 SIHGIVLTMFDSRNNLSNQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDLKC 259

Query: 242 AGSQAYLKLASELIQQER 259
            GS+AYLKLA+E+IQ+ER
Sbjct: 260 TGSEAYLKLATEVIQRER 277


>gi|217978728|ref|YP_002362875.1| Cobyrinic acid ac-diamide synthase [Methylocella silvestris BL2]
 gi|217504104|gb|ACK51513.1| Cobyrinic acid ac-diamide synthase [Methylocella silvestris BL2]
          Length = 282

 Score =  364 bits (935), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 174/262 (66%), Positives = 214/262 (81%), Gaps = 10/262 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE VLLIDLDPQGNASTGLG+E   R+ S+YD
Sbjct: 17  RVLVLANQKGGVGKTTTAINLGTALAAIGEKVLLIDLDPQGNASTGLGVERRSRRVSTYD 76

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +++  +++ +++  TA+P LSI PST+DLLG+E+ + G KDR  RL  A++ +   D   
Sbjct: 77  VMMGAESLKKVMQPTAVPGLSIAPSTLDLLGVELEIAGRKDRALRLKNAIA-RFVEDQQG 135

Query: 124 ------FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
                 F+Y  +DCPPS NLLTMNAM AADS++VPLQCEFFALEGLSQLL TV++VR T+
Sbjct: 136 EPPSERFTYALVDCPPSLNLLTMNAMTAADSVVVPLQCEFFALEGLSQLLATVDQVRSTL 195

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           N AL I GI+LTMFDSRNSL+ QVV+DVR  +G KVY+TVIPRNVRISEAPS+GKP ++Y
Sbjct: 196 NPALTIHGIVLTMFDSRNSLAAQVVADVRSFMGDKVYDTVIPRNVRISEAPSHGKPVLLY 255

Query: 238 DLKCAGSQAYLKLASELIQQER 259
           DLKCAGSQAYLKLASE+IQ+ER
Sbjct: 256 DLKCAGSQAYLKLASEVIQRER 277


>gi|90421004|ref|ZP_01228908.1| chromosome partitioning protein ParA [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334782|gb|EAS48558.1| chromosome partitioning protein ParA [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 276

 Score =  364 bits (934), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 215/266 (80%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  +  RIITIANQKGGVGKTTTAINL+TALAAIG+  LLIDLDPQGNASTGLG++  +R
Sbjct: 11  MSGQPMRIITIANQKGGVGKTTTAINLATALAAIGKRALLIDLDPQGNASTGLGVDRDNR 70

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           + SSYD+L E  +I +  + TA+PNLS+IPST+DLLG+EM + G   R +RL  AL    
Sbjct: 71  EVSSYDVLTEASSITEAAMPTAVPNLSLIPSTLDLLGLEMEIAGATGRAYRLRDALHFHQ 130

Query: 121 --TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
             T  F ++ +DCPPS NLLT+NAMAAADSILVPLQCEFFALEGLSQLL+TVE+VR ++N
Sbjct: 131 VETPQFDFVLIDCPPSLNLLTINAMAAADSILVPLQCEFFALEGLSQLLQTVEQVRDSLN 190

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             LD+ GI+LTM+D RN+L+ QVV DVR  +G  VY T+IPRNVR+SEAPS+GKPAI+YD
Sbjct: 191 PTLDLHGIVLTMYDGRNNLAAQVVRDVRSYMGDHVYETIIPRNVRVSEAPSFGKPAILYD 250

Query: 239 LKCAGSQAYLKLASELIQQERHRKEA 264
           +KC GSQAY++LASE+IQ+ER  + A
Sbjct: 251 MKCPGSQAYIRLASEIIQRERGLQAA 276


>gi|319899515|ref|YP_004159612.1| chromosome partitioning protein ParA [Bartonella clarridgeiae 73]
 gi|319403483|emb|CBI77063.1| chromosome partitioning protein ParA [Bartonella clarridgeiae 73]
          Length = 265

 Score =  363 bits (933), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 171/263 (65%), Positives = 219/263 (83%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTT INL+TALAAIGEN+L++D+DPQGNASTGLGI+   R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTTINLATALAAIGENILIMDIDPQGNASTGLGIDRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--QLTS 122
           YD+L+   ++ +  ++TA+PNL I+PST+DLLGIEM +   +DR+ RL KAL    ++  
Sbjct: 63  YDVLVSGISVAEAALRTAVPNLHIVPSTLDLLGIEMEIASSQDRIQRLRKALCYDSKIAK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AA+S+LVP+QCEF ALEGLSQLLETV++VR  +N++L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAANSVLVPMQCEFLALEGLSQLLETVKQVRSILNTSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEVIQREKQAQAAA 265


>gi|92115735|ref|YP_575464.1| cobyrinic acid a,c-diamide synthase [Nitrobacter hamburgensis X14]
 gi|91798629|gb|ABE61004.1| chromosome segregation ATPase [Nitrobacter hamburgensis X14]
          Length = 286

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/258 (67%), Positives = 214/258 (82%), Gaps = 5/258 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII++ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR  S+YD
Sbjct: 23  RIISLANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNVSTYD 82

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV-----QLT 121
           +LI E  +   ++ TA+P L I  STMDL G+E+ LG  KDR FRL  A++         
Sbjct: 83  VLIGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGTTKDRAFRLRDAIAALNGNAADH 142

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           SD++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+N  L
Sbjct: 143 SDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTLNPNL 202

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDLKC
Sbjct: 203 SIHGIVLTMFDSRNNLSNQVVADVRQFMGSKVYDTMIPRNVRISEAPSYGKPVLVYDLKC 262

Query: 242 AGSQAYLKLASELIQQER 259
           +GS+AYLKLA+E+IQ+ER
Sbjct: 263 SGSEAYLKLATEVIQRER 280


>gi|49474826|ref|YP_032868.1| chromosome partitioning protein para [Bartonella quintana str.
           Toulouse]
 gi|49240330|emb|CAF26812.1| Chromosome partitioning protein para [Bartonella quintana str.
           Toulouse]
          Length = 265

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 172/263 (65%), Positives = 216/263 (82%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTTAINL+TALAAIGENVL++D+DPQGNASTGLGI    R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTAINLATALAAIGENVLIMDIDPQGNASTGLGINRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTS 122
           YD+LI   ++ +  ++TA+PNLSI+PST+DLLG+EM +   +DR+ RL KA     ++  
Sbjct: 63  YDVLISGVSVTKAALKTAVPNLSIVPSTLDLLGVEMEIASSQDRIQRLRKAFYDDPKMAK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM  ADS+LVP+QCEF ALEGLSQLLETV++V+  +N +L 
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGTADSVLVPMQCEFLALEGLSQLLETVKQVQSVLNPSLK 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFIGDKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEVIQREKQAQAAA 265


>gi|114705863|ref|ZP_01438766.1| chromosome partitioning protein, ParA [Fulvimarina pelagi HTCC2506]
 gi|114538709|gb|EAU41830.1| chromosome partitioning protein, ParA [Fulvimarina pelagi HTCC2506]
          Length = 261

 Score =  361 bits (927), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 172/256 (67%), Positives = 210/256 (82%), Gaps = 2/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+ITIANQKGGVGKTTTAINL+TALAA+G+ VLL+DLDPQGNASTGLGIE  DR+ SSYD
Sbjct: 2   RVITIANQKGGVGKTTTAINLATALAAVGKRVLLVDLDPQGNASTGLGIEKDDREVSSYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL E  ++ +  I TA+P LS+IPST+DLLG+EM +     R +RL  AL    +  + F
Sbjct: 62  LLTERASVEEAAIPTAVPELSLIPSTLDLLGLEMEISSADRRAYRLRDALREHEKREARF 121

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            ++ +DCPPS NLLT+NAMAAADS+LVPLQCEFFALEGLSQLL+TVEEVR ++N  LD+ 
Sbjct: 122 DFVLMDCPPSLNLLTINAMAAADSVLVPLQCEFFALEGLSQLLQTVEEVRDSLNPELDLH 181

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN+L+ QVV DVR  +G  VY TVIPRNVR+SEAPS+GKPAI+YD+KC GS
Sbjct: 182 GIVLTMFDGRNNLAAQVVRDVRAYMGESVYQTVIPRNVRVSEAPSFGKPAILYDMKCPGS 241

Query: 245 QAYLKLASELIQQERH 260
           QAY+ LASE+IQ+E+ 
Sbjct: 242 QAYIALASEVIQREKR 257


>gi|319404909|emb|CBI78510.1| chromosome partitioning protein ParA [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319407869|emb|CBI81522.1| chromosome partitioning protein ParA [Bartonella sp. 1-1C]
          Length = 265

 Score =  361 bits (926), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 170/263 (64%), Positives = 218/263 (82%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTT INL+TALAAIG+N+L++D+DPQGNASTGLGI+   R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTTINLATALAAIGKNILIMDIDPQGNASTGLGIDRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS--VQLTS 122
           YD+L+   ++    ++TA+PNL I+PST+DLLGIEM +   +DR+ RL KAL    ++  
Sbjct: 63  YDVLVSGISVADAALETAVPNLHIVPSTLDLLGIEMEIASSQDRIQRLRKALCHDSKIAK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AA+S+LVP+QCEF ALEGLSQLLETV++VR  +N++L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAANSVLVPMQCEFLALEGLSQLLETVKQVRSILNTSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEVIQREKQAQAAA 265


>gi|91974912|ref|YP_567571.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           BisB5]
 gi|91681368|gb|ABE37670.1| chromosome segregation ATPase [Rhodopseudomonas palustris BisB5]
          Length = 284

 Score =  360 bits (925), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 213/263 (80%), Gaps = 5/263 (1%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E  + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR 
Sbjct: 16  EPGRPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRN 75

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--- 118
            S+YD+L  E  +   ++ TA+P L I  STMDL G+E+ LG  +DR FRL  A++V   
Sbjct: 76  CSTYDVLAGEAPLRDAVVATAVPRLHIAASTMDLSGLELELGHSRDRAFRLRDAIAVLNK 135

Query: 119 --QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
                 D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T
Sbjct: 136 DVDPPLDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRST 195

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++
Sbjct: 196 LNPELTIHGIVLTMFDSRNNLSSQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLV 255

Query: 237 YDLKCAGSQAYLKLASELIQQER 259
           YDLKC GS+AYLKLA+E+IQ+ER
Sbjct: 256 YDLKCVGSEAYLKLATEVIQRER 278


>gi|86747515|ref|YP_484011.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           HaA2]
 gi|86570543|gb|ABD05100.1| chromosome segregation ATPase [Rhodopseudomonas palustris HaA2]
          Length = 271

 Score =  360 bits (925), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 213/263 (80%), Gaps = 5/263 (1%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E  + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR 
Sbjct: 3   EPGRPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRN 62

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--- 118
            S+YD+L  E  +   ++ TA+P L I  STMDL G+E+ LG  +DR FRL  A++V   
Sbjct: 63  CSTYDVLAGEAPLRDAVVPTAVPRLHIAASTMDLSGLELELGHTRDRAFRLRDAIAVLNK 122

Query: 119 --QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
                 D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T
Sbjct: 123 DVDPPLDYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRST 182

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++
Sbjct: 183 LNPELTIHGIVLTMFDSRNNLSSQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLV 242

Query: 237 YDLKCAGSQAYLKLASELIQQER 259
           YDLKC GS+AYLKLA+E+IQ+ER
Sbjct: 243 YDLKCVGSEAYLKLATEVIQRER 265


>gi|121601810|ref|YP_988352.1| chromosome partitioning protein ParA [Bartonella bacilliformis
           KC583]
 gi|120613987|gb|ABM44588.1| chromosome partitioning protein ParA [Bartonella bacilliformis
           KC583]
          Length = 265

 Score =  359 bits (922), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/263 (64%), Positives = 217/263 (82%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII +ANQKGGVGKTTT INL+TALAAIG+NVL++D+DPQGNAST LGI+  +R  SS
Sbjct: 3   ETRIIAVANQKGGVGKTTTTINLATALAAIGKNVLIMDIDPQGNASTALGIDRNNRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS--VQLTS 122
           YD+L+   +I +  ++T +PNL I+PST+DLLG+EM +    DR+ RL KAL    ++  
Sbjct: 63  YDVLVSGVSIAKAALKTVVPNLHIVPSTLDLLGVEMEIASSLDRIKRLRKALCDDQKVAK 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AADS+LVP+QCEF ALEGLSQLLETV++VR  +N +L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAADSVLVPMQCEFLALEGLSQLLETVKQVRYALNPSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKPA++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNVRVSEAPSFGKPALLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEVIQREKQAEAAA 265


>gi|319406395|emb|CBI80036.1| chromosome partitioning protein ParA [Bartonella sp. AR 15-3]
          Length = 265

 Score =  359 bits (921), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/263 (63%), Positives = 218/263 (82%), Gaps = 2/263 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII IANQKGGVGKTTT +NL+TALAA+G+N+L++D+DPQGNAST LGI+   R  SS
Sbjct: 3   ETRIIAIANQKGGVGKTTTTVNLATALAAVGKNILIMDIDPQGNASTALGIDRNSRPLSS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--QLTS 122
           YD+L+   ++    + TA+PNL I+PST+DLLGIEM +   +DR+ RL KAL    ++T+
Sbjct: 63  YDVLVSGVSVADAALNTAVPNLHIVPSTLDLLGIEMEIASSQDRIQRLRKALCHDDKITT 122

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+YI +DCPPS NLLT+NAM AA+S+LVP+QCEF ALEGLSQLLETV++VR  +N++L+
Sbjct: 123 KFNYILIDCPPSLNLLTLNAMGAANSVLVPMQCEFLALEGLSQLLETVKQVRSVLNTSLE 182

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN+LS QVV DVR  +G KVY TVIPRNVR+SEAPS+GKP ++YDLKCA
Sbjct: 183 IQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNVRVSEAPSFGKPVLLYDLKCA 242

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GSQAYL+LASE+IQ+E+  + AA
Sbjct: 243 GSQAYLRLASEVIQREKQGQVAA 265


>gi|146337360|ref|YP_001202408.1| chromosome partitioning protein [Bradyrhizobium sp. ORS278]
 gi|146190166|emb|CAL74158.1| chromosome partitioning protein [Bradyrhizobium sp. ORS278]
          Length = 283

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 173/262 (66%), Positives = 213/262 (81%), Gaps = 5/262 (1%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           E   RI+ +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+   R  
Sbjct: 17  EGHPRILALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRGSRNC 76

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS----- 117
           S+YD+LI E ++   ++ TA+P L I  STMDL G+E+ LG   +R FRL  A++     
Sbjct: 77  STYDVLIGEASLRDAVVATAVPRLHIASSTMDLSGLELELGTSANRAFRLRDAIAGLNNN 136

Query: 118 VQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
           V   +D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+
Sbjct: 137 VSPENDYTYVLVDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTL 196

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           N  L I GI+LTMFDSRN+LS QVV+DVR+ +G KVYNT+IPRNVRISEAPSYGKP ++Y
Sbjct: 197 NPNLSIHGIVLTMFDSRNNLSNQVVADVRQFMGSKVYNTMIPRNVRISEAPSYGKPVLVY 256

Query: 238 DLKCAGSQAYLKLASELIQQER 259
           DLKC GS+AYLKLA+E+IQ+ER
Sbjct: 257 DLKCVGSEAYLKLATEVIQRER 278


>gi|39933369|ref|NP_945645.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           CGA009]
 gi|192288725|ref|YP_001989330.1| Cobyrinic acid ac-diamide synthase [Rhodopseudomonas palustris
           TIE-1]
 gi|39652994|emb|CAE25736.1| chromosome partitioning protein, ParA [Rhodopseudomonas palustris
           CGA009]
 gi|192282474|gb|ACE98854.1| Cobyrinic acid ac-diamide synthase [Rhodopseudomonas palustris
           TIE-1]
          Length = 284

 Score =  358 bits (920), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 174/263 (66%), Positives = 211/263 (80%), Gaps = 5/263 (1%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E  + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR 
Sbjct: 16  EPGRPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRN 75

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--- 118
            S+YD+L  E  +   ++ TA+P L I  STMDL G+E+ LG   DR FRL  A+ V   
Sbjct: 76  TSTYDVLAGEAPLRDAVVATAVPRLHIAASTMDLSGLELELGHRGDRAFRLRDAIGVLNK 135

Query: 119 --QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
                 D++Y+ +DCPPS NLLT+NAMAAAD+ILVPLQCEFFALEGLSQLL+TVE+VR  
Sbjct: 136 DIDPPLDYTYVLIDCPPSLNLLTVNAMAAADAILVPLQCEFFALEGLSQLLQTVEQVRAN 195

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N +L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++
Sbjct: 196 LNPSLTIHGIVLTMFDSRNNLSSQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLV 255

Query: 237 YDLKCAGSQAYLKLASELIQQER 259
           YDLKC GS+AYLKLA+E+IQ+ER
Sbjct: 256 YDLKCVGSEAYLKLATEVIQRER 278


>gi|148251785|ref|YP_001236370.1| chromosome segregation ATPase [Bradyrhizobium sp. BTAi1]
 gi|146403958|gb|ABQ32464.1| chromosome segregation ATPase [Bradyrhizobium sp. BTAi1]
          Length = 283

 Score =  358 bits (918), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 172/262 (65%), Positives = 213/262 (81%), Gaps = 5/262 (1%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           +   RI+ +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+   R  
Sbjct: 17  DGHPRILALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRGSRNC 76

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS----- 117
           S+YD+LI E ++   ++ TA+P L I  STMDL G+E+ LG   +R FRL  A++     
Sbjct: 77  STYDVLIGEASLRDAVVATAVPRLHIASSTMDLSGLELELGNSANRAFRLRDAIAGLNNN 136

Query: 118 VQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
           V   +D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR T+
Sbjct: 137 VSPENDYTYVLVDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRSTL 196

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           N  L I GI+LTMFDSRN+LS QVV+DVR+ +G KVYNT+IPRNVRISEAPSYGKP ++Y
Sbjct: 197 NPNLSIHGIVLTMFDSRNNLSNQVVADVRQFMGSKVYNTMIPRNVRISEAPSYGKPVLVY 256

Query: 238 DLKCAGSQAYLKLASELIQQER 259
           DLKC GS+AYLKLA+E+IQ+ER
Sbjct: 257 DLKCVGSEAYLKLATEVIQRER 278


>gi|299133192|ref|ZP_07026387.1| Cobyrinic acid ac-diamide synthase [Afipia sp. 1NLS2]
 gi|298593329|gb|EFI53529.1| Cobyrinic acid ac-diamide synthase [Afipia sp. 1NLS2]
          Length = 282

 Score =  356 bits (914), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 213/260 (81%), Gaps = 5/260 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  +R  S+
Sbjct: 18  QPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRNCST 77

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT--- 121
           YD+LI E  + + ++ TA+P L I  STMDL G+E+ LG  +DR FRL  A+S   T   
Sbjct: 78  YDVLIGEARLREAIVPTAVPRLHIAASTMDLSGLELELGTARDRAFRLRDAISDLNTDAP 137

Query: 122 --SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
             +D++Y+ +DCPPS NL+T+NAMAA+ +ILVPLQCEFFALEGLSQLL+TVE+VR T+N 
Sbjct: 138 EGADYTYVLVDCPPSLNLITVNAMAASHAILVPLQCEFFALEGLSQLLQTVEQVRSTLNP 197

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDL
Sbjct: 198 TLSIHGIVLTMFDSRNNLSNQVVADVRQFMGDKVYDTMIPRNVRISEAPSYGKPVLVYDL 257

Query: 240 KCAGSQAYLKLASELIQQER 259
           KC GS AYLKLA+E+IQ+ER
Sbjct: 258 KCVGSDAYLKLATEVIQRER 277


>gi|316931727|ref|YP_004106709.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           DX-1]
 gi|315599441|gb|ADU41976.1| cobyrinic acid a,c-diamide synthase [Rhodopseudomonas palustris
           DX-1]
          Length = 284

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 172/260 (66%), Positives = 210/260 (80%), Gaps = 5/260 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  DR  S+
Sbjct: 19  RPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRDRNTST 78

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV-----Q 119
           YD+L  E  +   ++ TA+P L I  STMDL G+E+ LG   DR +RL  A+ V      
Sbjct: 79  YDVLAGEAPLRDAVVATAVPRLHIAASTMDLSGLELELGHRGDRAYRLRDAIGVLNKDID 138

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
              D++Y+ +DCPPS NLLT+NAMAAAD+ILVPLQCEFFALEGLSQLL+TVE+VR  +N 
Sbjct: 139 PPLDYTYVLIDCPPSLNLLTVNAMAAADAILVPLQCEFFALEGLSQLLQTVEQVRANLNP 198

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
           +L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDL
Sbjct: 199 SLTIHGIVLTMFDSRNNLSSQVVADVRQFMGKKVYDTMIPRNVRISEAPSYGKPVLVYDL 258

Query: 240 KCAGSQAYLKLASELIQQER 259
           KC GS+AYLKLA+E+IQ+ER
Sbjct: 259 KCVGSEAYLKLATEVIQRER 278


>gi|27375742|ref|NP_767271.1| chromosome partitioning protein A [Bradyrhizobium japonicum USDA
           110]
 gi|27348880|dbj|BAC45896.1| chromosome partitioning protein A [Bradyrhizobium japonicum USDA
           110]
          Length = 284

 Score =  356 bits (913), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 214/264 (81%), Gaps = 5/264 (1%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           + +   RI+ +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  +R
Sbjct: 15  VPQGHPRILALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNR 74

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL---- 116
             S+YD+L+ E  + + ++ TA+P L I PSTMDL G+E+ LG    R F+L  A+    
Sbjct: 75  SCSTYDVLVGEAALREAVVSTAVPRLHIAPSTMDLSGLELELGTTPGRAFKLRDAIGALN 134

Query: 117 -SVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRR 175
            +V   +D++Y+ +DCPPS NLLT+NAMAA+D+ILVPLQCEFFALEGLSQLL+TVE+VR 
Sbjct: 135 NNVSPDADYTYVLIDCPPSLNLLTVNAMAASDAILVPLQCEFFALEGLSQLLQTVEQVRS 194

Query: 176 TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAI 235
           T+N  L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY T+IPRNVRISEAPSYGKP +
Sbjct: 195 TLNPNLSIHGIVLTMFDSRNNLSNQVVADVRQFMGEKVYKTMIPRNVRISEAPSYGKPVL 254

Query: 236 IYDLKCAGSQAYLKLASELIQQER 259
           +YDLKC GS+AYL+LA+E+IQ+ER
Sbjct: 255 VYDLKCVGSEAYLRLATEVIQRER 278


>gi|209883522|ref|YP_002287379.1| chromosome partitioning protein ParA [Oligotropha carboxidovorans
           OM5]
 gi|209871718|gb|ACI91514.1| chromosome partitioning protein ParA [Oligotropha carboxidovorans
           OM5]
          Length = 283

 Score =  354 bits (909), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 170/260 (65%), Positives = 213/260 (81%), Gaps = 5/260 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RII +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGI+  +R  S+
Sbjct: 19  QPRIIALANQKGGVGKTTTAINLGTALAAIGERVLIVDLDPQGNASTGLGIDRRNRNCST 78

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT--- 121
           YD+LI E  + + ++ TA+P L I  STMDL G+E+ LG  +DR FRL  A++   T   
Sbjct: 79  YDVLIGEAKLREAIVPTAVPRLHIAASTMDLSGLELELGTARDRAFRLRDAIADLNTDAP 138

Query: 122 --SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
             +D++Y+ +DCPPS NL+T+NAMAA+ +ILVPLQCEFFALEGLSQLL+TVE+VR T+N 
Sbjct: 139 EGADYTYVLVDCPPSLNLITVNAMAASHAILVPLQCEFFALEGLSQLLQTVEQVRSTLNP 198

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTMFDSRN+LS QVV+DVR+ +G KVY+T+IPRNVRISEAPSYGKP ++YDL
Sbjct: 199 TLSIHGIVLTMFDSRNNLSNQVVADVREFMGDKVYDTMIPRNVRISEAPSYGKPVLVYDL 258

Query: 240 KCAGSQAYLKLASELIQQER 259
           KC GS AYL+LA+E+IQ+ER
Sbjct: 259 KCVGSDAYLRLATEVIQRER 278


>gi|307943445|ref|ZP_07658789.1| sporulation initiation inhibitor protein Soj [Roseibium sp.
           TrichSKD4]
 gi|307773075|gb|EFO32292.1| sporulation initiation inhibitor protein Soj [Roseibium sp.
           TrichSKD4]
          Length = 274

 Score =  353 bits (907), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 174/266 (65%), Positives = 212/266 (79%), Gaps = 8/266 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGIE  DR  S+YD
Sbjct: 9   RVLALANQKGGVGKTTTAINLGTALAAIGEKVLVIDLDPQGNASTGLGIERRDRGLSTYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  + ++++ + +TA+  L + PSTMDLLG+E+ +    DR FRL  A+  QLT     
Sbjct: 69  VLSGDCSLDEAVKETAVNRLWVAPSTMDLLGLELEIASSSDRAFRLRNAVQ-QLTRSRLF 127

Query: 124 ----FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               F+Y+ +DCPPS NLLT+NA+AA+ SILVPLQCEFFALEGLSQLL TVE+VR  +N 
Sbjct: 128 QEVGFTYVLVDCPPSLNLLTINALAASHSILVPLQCEFFALEGLSQLLSTVEQVRNALNG 187

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTM+DSRN+LS QVV+DVR+ +G  VY TVIPRNVRISEAPSYGKPA++YDL
Sbjct: 188 ELTIHGIVLTMYDSRNNLSSQVVTDVRETMGDAVYETVIPRNVRISEAPSYGKPALLYDL 247

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYLKLASE+IQ+ER  +  A
Sbjct: 248 KCAGSQAYLKLASEIIQRERDLRRVA 273


>gi|328541703|ref|YP_004301812.1| CobQ/CobB/MinD/ParA nucleotide binding domain [polymorphum gilvum
           SL003B-26A1]
 gi|326411455|gb|ADZ68518.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative
           [Polymorphum gilvum SL003B-26A1]
          Length = 265

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 170/264 (64%), Positives = 211/264 (79%), Gaps = 6/264 (2%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           ++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGIE  DR  S+YD+
Sbjct: 1   MLALANQKGGVGKTTTAINLGTALAAIGERVLVIDLDPQGNASTGLGIERRDRGLSTYDV 60

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS------VQLT 121
           L  + ++++ +  TA+P L + PSTMDLLG+E+ +    DR FRL KA+       +Q  
Sbjct: 61  LCGDCSLDEAIKSTAVPRLWVAPSTMDLLGLELEIAASSDRAFRLRKAIERFVHSRLQEE 120

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS NLLT+NA++A+ SILVPLQCEFFALEGLSQLL TVE+VR  +N  L
Sbjct: 121 VGFTYVLVDCPPSLNLLTINALSASHSILVPLQCEFFALEGLSQLLSTVEQVRTALNPEL 180

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I GI+LTM+DSRN+LS QVV+DVR+ +G  VY T+IPRNVRISEAPSYGKPA++YDLKC
Sbjct: 181 TIHGIVLTMYDSRNNLSSQVVADVRETMGDAVYETIIPRNVRISEAPSYGKPALLYDLKC 240

Query: 242 AGSQAYLKLASELIQQERHRKEAA 265
           AGSQAYL+LASE+IQ+ER  +  A
Sbjct: 241 AGSQAYLRLASEIIQRERELRRIA 264


>gi|298293753|ref|YP_003695692.1| cobyrinic acid ac-diamide synthase [Starkeya novella DSM 506]
 gi|296930264|gb|ADH91073.1| Cobyrinic acid ac-diamide synthase [Starkeya novella DSM 506]
          Length = 287

 Score =  352 bits (902), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 166/269 (61%), Positives = 215/269 (79%), Gaps = 10/269 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE+VL++DLDPQGNASTGLGI+   R+ S+YD
Sbjct: 18  RVLALANQKGGVGKTTTAINLGTALAAIGESVLVVDLDPQGNASTGLGIDRRSRRVSTYD 77

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRL----------DKAL 116
           +L  E ++ + +++TA+P L I  STMDL G+E+ L  ++DR +RL          D + 
Sbjct: 78  VLTGEVSLREAILETAVPRLHIAASTMDLSGLELELASQRDRAYRLRDAIRRLNLRDDSF 137

Query: 117 SVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
            V+   ++SY+ +DCPPS NL+T+NAMAAA++ILVPLQCEFFALEGLSQLL+TVE+VR T
Sbjct: 138 QVRNNVEYSYVLIDCPPSLNLITVNAMAAANAILVPLQCEFFALEGLSQLLKTVEQVRST 197

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L I GI+LTM+D+RN+LS QVV DVR+ +G KVY T+IPRNVR+SEAPSYGKP ++
Sbjct: 198 LNPELSIHGIVLTMYDARNNLSAQVVEDVRQFMGEKVYETIIPRNVRVSEAPSYGKPVLL 257

Query: 237 YDLKCAGSQAYLKLASELIQQERHRKEAA 265
           YDLKC GSQAYL+LASE+IQ+ER  +  A
Sbjct: 258 YDLKCVGSQAYLRLASEIIQRERALRAPA 286


>gi|154245780|ref|YP_001416738.1| cobyrinic acid ac-diamide synthase [Xanthobacter autotrophicus Py2]
 gi|154159865|gb|ABS67081.1| Cobyrinic acid ac-diamide synthase [Xanthobacter autotrophicus Py2]
          Length = 282

 Score =  351 bits (900), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 165/254 (64%), Positives = 207/254 (81%), Gaps = 4/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE VL++DLDPQGNASTGLGIE   R  S+YD
Sbjct: 18  RVLALANQKGGVGKTTTAINLGTALAAIGETVLVVDLDPQGNASTGLGIERRARNLSTYD 77

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV----QLTS 122
           +L  E ++ + +++T +P L + PST+DL G+E+ +  E+DR FRL  AL       L  
Sbjct: 78  VLTGEASMRETVMETGVPQLYVAPSTLDLSGLELEIAAERDRAFRLRSALKALAADSLAP 137

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F+Y+ +DCPPS +LLT+NAMAAAD+I+VPLQCEFFALEGLSQLL+TVE+VR ++N AL 
Sbjct: 138 RFTYVLVDCPPSLSLLTVNAMAAADAIVVPLQCEFFALEGLSQLLKTVEQVRVSLNPALT 197

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I GI+LTM+D RN+LS+QVV DVR+ +G KVY TVIPRNVR+SEAPSYGKP ++YDLKC 
Sbjct: 198 IHGIVLTMYDGRNNLSEQVVQDVRQFMGDKVYETVIPRNVRVSEAPSYGKPVLLYDLKCV 257

Query: 243 GSQAYLKLASELIQ 256
           GSQAYL+LASE+IQ
Sbjct: 258 GSQAYLRLASEVIQ 271


>gi|323135831|ref|ZP_08070914.1| cobyrinic acid ac-diamide synthase [Methylocystis sp. ATCC 49242]
 gi|322398922|gb|EFY01441.1| cobyrinic acid ac-diamide synthase [Methylocystis sp. ATCC 49242]
          Length = 272

 Score =  349 bits (895), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 163/264 (61%), Positives = 213/264 (80%), Gaps = 6/264 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAA+GE VL+IDLDPQGNASTGLG+E   RK S+YD
Sbjct: 9   RVLVLANQKGGVGKTTTAINLGTALAAVGEQVLVIDLDPQGNASTGLGVERKSRKLSTYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT----- 121
           +L+ E ++   ++ TA+P LSI PST+DLLG+E+ +  +KDR FRL +AL+         
Sbjct: 69  VLLGESSLADAIVATAVPRLSIAPSTLDLLGVELEIAADKDRAFRLKRALAELAAAEAHD 128

Query: 122 -SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              + YI +DCPPS NLLT+NA+A+AD+++VPLQCEFFALEGLSQLL TV++V RT+N  
Sbjct: 129 GKRYDYILIDCPPSLNLLTINALASADAVVVPLQCEFFALEGLSQLLSTVDQVTRTLNPK 188

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I G++LTM+D RN+L+ QV +DVR+ +G KVY T+IPRNVR+SEAPS+GKP ++YDLK
Sbjct: 189 LSIHGVVLTMYDPRNNLATQVAADVRRFMGDKVYETMIPRNVRVSEAPSHGKPVLLYDLK 248

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           C+GSQAYLKLASE+IQ+E+  + A
Sbjct: 249 CSGSQAYLKLASEVIQREKRLRAA 272


>gi|154251729|ref|YP_001412553.1| cobyrinic acid ac-diamide synthase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155679|gb|ABS62896.1| Cobyrinic acid ac-diamide synthase [Parvibaculum lavamentivorans
           DS-1]
          Length = 317

 Score =  348 bits (894), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 208/277 (75%), Gaps = 16/277 (5%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RI+ +ANQKGGVGKTTTAINL TALAA+GE VL++DLDPQGNASTGLGI  ++RK S+
Sbjct: 40  RPRILVVANQKGGVGKTTTAINLGTALAAVGERVLIVDLDPQGNASTGLGIGRHERKVSA 99

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS------- 117
           YD+LI    I   ++ T +P L I+PSTMDLLG E+ L     R  RL  AL+       
Sbjct: 100 YDVLIGSALIEDAVVPTKVPGLDIVPSTMDLLGAELELASVPRRSHRLRDALARMPRNGK 159

Query: 118 --------VQLTS-DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLE 168
                    Q+T   +SY+ +DCPPS NLLT+NAM AAD+ILVPLQCEFFALEGLSQLL 
Sbjct: 160 ARETSEAETQMTPRPYSYLLIDCPPSLNLLTINAMTAADAILVPLQCEFFALEGLSQLLR 219

Query: 169 TVEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAP 228
           TVE V+ ++N  L+IQGI+LTMFD RN LS QV SDVR  LG KVY TVIPRNVRISEAP
Sbjct: 220 TVERVKTSLNPRLEIQGIVLTMFDQRNKLSDQVASDVRGYLGDKVYRTVIPRNVRISEAP 279

Query: 229 SYGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEAA 265
           SYGKPA++YD +CAGS+AY+KLA+E+IQ+ER  K  A
Sbjct: 280 SYGKPALVYDHRCAGSKAYMKLAAEMIQRERALKRNA 316


>gi|197106982|ref|YP_002132359.1| chromosome partitioning protein ParA [Phenylobacterium zucineum
           HLK1]
 gi|196480402|gb|ACG79930.1| chromosome partitioning protein ParA [Phenylobacterium zucineum
           HLK1]
          Length = 275

 Score =  348 bits (893), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 160/264 (60%), Positives = 215/264 (81%), Gaps = 1/264 (0%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           ++  R++ +ANQKGGVGKTTTAINL TALAA+GE VLLID DPQGNASTGLG+    RK+
Sbjct: 6   DRSLRVLVVANQKGGVGKTTTAINLGTALAAVGEKVLLIDSDPQGNASTGLGVGRAQRKH 65

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLT 121
           + YD+L+ EK +++ +++T++P L I+P+  DL G+E+ LG +  R F+L  ALS ++  
Sbjct: 66  TLYDVLMGEKPVHEAVVKTSVPGLDIVPADPDLSGVELELGQQARRSFKLRDALSPLRAE 125

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             ++Y+ +DCPPS NLLT+NAMAAAD++LVPLQCEFFALEGL+QL+ T++ VR ++N AL
Sbjct: 126 GGYTYVLIDCPPSLNLLTVNAMAAADAVLVPLQCEFFALEGLTQLMRTIDLVRGSLNPAL 185

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           +IQG+ILTM+D RNSLS+QV  DVR + G  VY TVIPRNVR+SEAPS+GKPA++YDL+C
Sbjct: 186 EIQGVILTMYDRRNSLSEQVARDVRGHFGETVYQTVIPRNVRVSEAPSFGKPALVYDLRC 245

Query: 242 AGSQAYLKLASELIQQERHRKEAA 265
           AGSQAYLKLA E++ +ER R++ A
Sbjct: 246 AGSQAYLKLAREVVLRERDRRKRA 269


>gi|158426335|ref|YP_001527627.1| chromosome partitioning protein [Azorhizobium caulinodans ORS 571]
 gi|158333224|dbj|BAF90709.1| chromosome partitioning protein [Azorhizobium caulinodans ORS 571]
          Length = 282

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/257 (64%), Positives = 208/257 (80%), Gaps = 6/257 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+   RK S+YD
Sbjct: 20  RILALANQKGGVGKTTTAINLGTALAAIGETVLVIDLDPQGNASTGLGIDRRARKLSTYD 79

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  E  + + + +T +P L + PST+DL G+E+ +  E+DR FRL  AL   L +D   
Sbjct: 80  VLSNEATLREAIQETGVPQLYVAPSTLDLSGLELEIASERDRAFRLRNALKA-LAADGEG 138

Query: 124 --FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             F+Y+ +DCPPS +L+T+NAMAAA +I+VPLQCEFFALEGLSQLL+TVE+VR  +N  L
Sbjct: 139 VQFTYVLIDCPPSLSLITVNAMAAAHAIVVPLQCEFFALEGLSQLLKTVEQVRTGLNPGL 198

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I GI+LTM+D+RN+LS QVV DVR+ +G KVY TVIPRNVR+SEAPSYGKP ++YDLKC
Sbjct: 199 SIHGIVLTMYDARNNLSDQVVEDVRQFMGEKVYETVIPRNVRVSEAPSYGKPVLLYDLKC 258

Query: 242 AGSQAYLKLASELIQQE 258
           AGSQAYL+LASE+IQ+E
Sbjct: 259 AGSQAYLRLASEVIQRE 275


>gi|254502364|ref|ZP_05114515.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438435|gb|EEE45114.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Labrenzia
           alexandrii DFL-11]
          Length = 274

 Score =  346 bits (888), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 211/266 (79%), Gaps = 8/266 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGIE  DR  S+Y+
Sbjct: 9   RVLALANQKGGVGKTTTAINLGTALAAIGEKVLVIDLDPQGNASTGLGIEHRDRGLSTYE 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  +  +++ + +TA+  L + PSTMDLLG+E+ +    DR FRL  A+   LT     
Sbjct: 69  ILSGDCAMDEAIRETAVQRLWVAPSTMDLLGLELEIASTSDRAFRLRNAIE-NLTHSRLF 127

Query: 124 ----FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               F+Y+ +DCPPS NLLT+NA++A+ SILVPLQCEFFALEGLSQLL TVE+V+  +N 
Sbjct: 128 KEIGFTYVLVDCPPSLNLLTINALSASHSILVPLQCEFFALEGLSQLLSTVEQVKSALNP 187

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTM+DSRN+LS QVV+DVR+ +G  VY+T+IPRNVRISEAPSYGKPA++YDL
Sbjct: 188 ELSIHGIVLTMYDSRNNLSSQVVADVRETMGEAVYDTIIPRNVRISEAPSYGKPALLYDL 247

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYL+LASE+IQ+ER  +  A
Sbjct: 248 KCAGSQAYLRLASEIIQRERQLRSVA 273


>gi|118591438|ref|ZP_01548836.1| Cobyrinic acid a,c-diamide synthase [Stappia aggregata IAM 12614]
 gi|118436110|gb|EAV42753.1| Cobyrinic acid a,c-diamide synthase [Stappia aggregata IAM 12614]
          Length = 274

 Score =  345 bits (886), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 168/266 (63%), Positives = 210/266 (78%), Gaps = 8/266 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGIE  DR  S+Y+
Sbjct: 9   RVLALANQKGGVGKTTTAINLGTALAAIGEKVLVIDLDPQGNASTGLGIEHRDRGLSTYE 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  + ++ + + +TA+  L + PSTMDLLG+E+ +    DR FRL  A+   LT     
Sbjct: 69  VLSGDCSLAEAVRETAVQRLWVAPSTMDLLGLELEIASTADRAFRLRSAIE-NLTHSRLF 127

Query: 124 ----FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               F+Y+ +DCPPS NLLT+NA++A+ SILVPLQCEFFALEGLSQLL TVE+V+  +N 
Sbjct: 128 QEIGFTYVLVDCPPSLNLLTINALSASHSILVPLQCEFFALEGLSQLLSTVEQVKNALNP 187

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L I GI+LTM+DSRN+LS QVV+DVR+ +G  VY T+IPRNVRISEAPSYGKPA++YDL
Sbjct: 188 ELSIHGIVLTMYDSRNNLSSQVVADVRETMGDAVYETIIPRNVRISEAPSYGKPALLYDL 247

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYL+LASE+IQ+ER  +  A
Sbjct: 248 KCAGSQAYLRLASEIIQRERELRRVA 273


>gi|188580908|ref|YP_001924353.1| Cobyrinic acid ac-diamide synthase [Methylobacterium populi BJ001]
 gi|179344406|gb|ACB79818.1| Cobyrinic acid ac-diamide synthase [Methylobacterium populi BJ001]
          Length = 286

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 165/259 (63%), Positives = 204/259 (78%), Gaps = 4/259 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  R++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+   RK S
Sbjct: 18  KPLRVLALANQKGGVGKTTTAINLGTALAAIGEQVLVIDLDPQGNASTGLGIDRRRRKVS 77

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           +Y ++  E  + + +  TA+P LS+ PSTMDLLG+E+ L    DR  RL   L    T +
Sbjct: 78  TYHVMAGEAPLAEAITPTAVPRLSVAPSTMDLLGLELELASAPDRAHRLRNILRELTTPE 137

Query: 124 ----FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
                SY+ +DCPPS NLLT+NA+AAAD+++VPLQCEFFALEGLSQLL TVE+VR  +N 
Sbjct: 138 GIEPVSYVLIDCPPSLNLLTINALAAADAVMVPLQCEFFALEGLSQLLRTVEQVRGALNP 197

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L IQG++LTM+D RN+LS QVV+DVR  +G KVY T+IPRNVR+SEAPS+GKP ++YDL
Sbjct: 198 KLQIQGVVLTMYDPRNNLSTQVVADVRGFMGDKVYETMIPRNVRVSEAPSHGKPVLLYDL 257

Query: 240 KCAGSQAYLKLASELIQQE 258
           KCAGSQAYL+LASE+IQ+E
Sbjct: 258 KCAGSQAYLRLASEVIQRE 276


>gi|329891182|ref|ZP_08269525.1| chromosome partitioning protein parA [Brevundimonas diminuta ATCC
           11568]
 gi|328846483|gb|EGF96047.1| chromosome partitioning protein parA [Brevundimonas diminuta ATCC
           11568]
          Length = 268

 Score =  341 bits (874), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 155/264 (58%), Positives = 213/264 (80%), Gaps = 3/264 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
            ++R++ ++NQKGGVGKTTTAINL TALAAIGE VL++D+DPQGNASTGLG+    R+ +
Sbjct: 2   HETRVLAVSNQKGGVGKTTTAINLGTALAAIGEKVLIVDMDPQGNASTGLGVPRETRRVT 61

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--- 120
            YD++++ + +++  I+TA+P L I+ +  D+ G+E+ L     R +RL  AL+ Q    
Sbjct: 62  IYDVIVDGRPVDEAAIETAVPGLFIVAADADMSGVEIELSQADRRSYRLRDALAKQGGNG 121

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
            + F Y+ +DCPPS NLLT+NAMAAAD++LVPLQCEFFALEGL+QL+ T++ VR+++N A
Sbjct: 122 HARFDYVLIDCPPSLNLLTLNAMAAADAVLVPLQCEFFALEGLTQLMRTIDMVRQSLNPA 181

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L+IQG++LTM+D RN+LS QV +DVR + G KVY++VIPRNVR+SEAPS+GKPA+IYDLK
Sbjct: 182 LEIQGLVLTMYDRRNALSGQVATDVRAHFGDKVYDSVIPRNVRVSEAPSFGKPALIYDLK 241

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAGSQAYLKLA EL+ +ER R++A
Sbjct: 242 CAGSQAYLKLARELVARERQRRQA 265


>gi|163851012|ref|YP_001639055.1| cobyrinic acid ac-diamide synthase [Methylobacterium extorquens
           PA1]
 gi|218529839|ref|YP_002420655.1| cobyrinic acid ac-diamide synthase [Methylobacterium
           chloromethanicum CM4]
 gi|240138143|ref|YP_002962615.1| chromosome partitioning protein, ATP-binding, nucleotide-binding
           [Methylobacterium extorquens AM1]
 gi|254560705|ref|YP_003067800.1| chromosome partitioning protein, ATP-binding, nucleotide-binding
           [Methylobacterium extorquens DM4]
 gi|163662617|gb|ABY29984.1| Cobyrinic acid ac-diamide synthase [Methylobacterium extorquens
           PA1]
 gi|218522142|gb|ACK82727.1| Cobyrinic acid ac-diamide synthase [Methylobacterium
           chloromethanicum CM4]
 gi|240008112|gb|ACS39338.1| chromosome partitioning protein, ATP-binding, nucleotide-binding
           [Methylobacterium extorquens AM1]
 gi|254267983|emb|CAX23851.1| chromosome partitioning protein, ATP-binding, nucleotide-binding
           [Methylobacterium extorquens DM4]
          Length = 286

 Score =  340 bits (872), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 203/262 (77%), Gaps = 6/262 (2%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
             K  R++ +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+   RK
Sbjct: 16  HPKPLRVLALANQKGGVGKTTTAINLGTALAAIGEQVLVIDLDPQGNASTGLGIDRRRRK 75

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            S+Y ++  E  +   +  TA+P LS+ PSTMDLLG+E+ L    DR  RL   L   LT
Sbjct: 76  VSTYHVMAGEAPLVDAITPTAVPRLSVAPSTMDLLGLELELASASDRAHRLRNILR-DLT 134

Query: 122 -----SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
                   SY+ +DCPPS NLLT+NA+AAAD+++VPLQCEFFALEGLSQLL TVE+VR  
Sbjct: 135 MPEGIEPISYVLIDCPPSLNLLTINALAAADAVMVPLQCEFFALEGLSQLLRTVEQVRGA 194

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L IQG++LTM+D RN+LS QVV+DVR  +G KVY T+IPRNVR+SEAPS+GKP ++
Sbjct: 195 LNPKLQIQGVVLTMYDPRNNLSTQVVADVRGFMGDKVYETMIPRNVRVSEAPSHGKPVLL 254

Query: 237 YDLKCAGSQAYLKLASELIQQE 258
           YDLKCAGSQAYL+LASE+IQ+E
Sbjct: 255 YDLKCAGSQAYLRLASEVIQRE 276


>gi|220921036|ref|YP_002496337.1| cobyrinic acid ac-diamide synthase [Methylobacterium nodulans ORS
           2060]
 gi|219945642|gb|ACL56034.1| Cobyrinic acid ac-diamide synthase [Methylobacterium nodulans ORS
           2060]
          Length = 282

 Score =  336 bits (861), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 172/265 (64%), Positives = 211/265 (79%), Gaps = 6/265 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+   R+ S+YD
Sbjct: 18  RIIALANQKGGVGKTTTAINLGTALAAIGERVLIIDLDPQGNASTGLGIDRRQRRLSTYD 77

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  E  + + +  TA+P L+I PSTMDLLG+EM +   +DR  RL + L     SD   
Sbjct: 78  VLAGEAPLREAIRATAVPRLAIAPSTMDLLGLEMEMASAQDRAHRLRRVLEPVTRSDLPD 137

Query: 124 ---FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F+Y+ +DCPPS NLLT+NA+AAAD++LVPLQCEFFALEGLSQLL TVE+V+  +N  
Sbjct: 138 EERFTYVLIDCPPSLNLLTINALAAADAVLVPLQCEFFALEGLSQLLRTVEQVKGALNPR 197

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L IQGI+LTMFD RN+LS QVV+DVR+ +G KVY+T+IPRNVR+SEAPS+GKP ++YDLK
Sbjct: 198 LAIQGIVLTMFDPRNNLSTQVVADVREFMGDKVYDTMIPRNVRVSEAPSHGKPVLLYDLK 257

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
           CAGSQAYL+LASE+IQ+E     AA
Sbjct: 258 CAGSQAYLRLASEIIQREGRLPAAA 282


>gi|315497186|ref|YP_004085990.1| chromosome partitioning protein para [Asticcacaulis excentricus CB
           48]
 gi|315415198|gb|ADU11839.1| chromosome partitioning protein ParA [Asticcacaulis excentricus CB
           48]
          Length = 273

 Score =  336 bits (861), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 157/262 (59%), Positives = 207/262 (79%), Gaps = 3/262 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ ++NQKGGVGKTTTAINL TALAA+GE VL+ID+DPQGNASTGLG+    R  + YD
Sbjct: 12  RVLAVSNQKGGVGKTTTAINLGTALAAVGETVLIIDMDPQGNASTGLGVPRSARTTTIYD 71

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           ++++++ I +  ++T++P L IIPS  DL G+E+ LG    R +RL  AL  Q       
Sbjct: 72  VIVDQQPIGECAVRTSVPGLYIIPSDPDLSGVEIELGQADRRSYRLRDALEHQAQVGELA 131

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           +SY+ +DCPPS NLLT+NAM+AAD++LVPLQCEFFALEGLSQL+ T++ V+ ++N  L++
Sbjct: 132 YSYVLIDCPPSLNLLTINAMSAADAVLVPLQCEFFALEGLSQLMRTIDLVKGSLNPKLEL 191

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QGI+LTMFD RN+LS  V  DVR + G KVY+TVIPRNVR+SEAPS+GKPA+IYDLKC G
Sbjct: 192 QGIVLTMFDRRNALSGHVAKDVRSHFGEKVYDTVIPRNVRVSEAPSFGKPALIYDLKCTG 251

Query: 244 SQAYLKLASELIQQERHRKEAA 265
           SQAYLKLA E++Q+E+ R+ AA
Sbjct: 252 SQAYLKLAREVVQREKVRRAAA 273


>gi|304392706|ref|ZP_07374646.1| sporulation initiation inhibitor protein Soj [Ahrensia sp. R2A130]
 gi|303295336|gb|EFL89696.1| sporulation initiation inhibitor protein Soj [Ahrensia sp. R2A130]
          Length = 273

 Score =  335 bits (860), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 171/264 (64%), Positives = 217/264 (82%), Gaps = 3/264 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + R+I +ANQKGGVGKTTTAINL+TALAAIGE VLLIDLDPQGNASTGLGI   +R  S+
Sbjct: 8   RPRVIALANQKGGVGKTTTAINLATALAAIGEEVLLIDLDPQGNASTGLGIGRDERDISA 67

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--TS 122
           YDL+     + Q +  TA+P LSI+P+T+DLLG+E  + G  DR+FRL KA++  L    
Sbjct: 68  YDLMDGSATLKQAVQPTAVPQLSIVPATLDLLGVETEIAGATDRMFRLKKAVAGHLGRNP 127

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           DF+YI +DCPPS NLLT+NA+AAA+ +LVPLQ EFFALEGLSQLL TV++VR+T+N+ L 
Sbjct: 128 DFTYILIDCPPSLNLLTLNALAAANGVLVPLQTEFFALEGLSQLLSTVDQVRQTLNNQLS 187

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           IQGI+LTM+D RN L++QV+ DVR+N+G  VY+TVIPRNVR+SEAPS+GKP ++YD+KCA
Sbjct: 188 IQGIVLTMYDKRNGLAKQVMEDVRENMGDLVYDTVIPRNVRVSEAPSFGKPVLLYDMKCA 247

Query: 243 GSQAYLKLASELIQQER-HRKEAA 265
           GSQAYLKLAS++IQ+E+ H K  A
Sbjct: 248 GSQAYLKLASQVIQREKLHNKRRA 271


>gi|302381486|ref|YP_003817309.1| chromosome partitioning protein ParA [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192114|gb|ADK99685.1| chromosome partitioning protein ParA [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 273

 Score =  335 bits (858), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 151/261 (57%), Positives = 207/261 (79%), Gaps = 3/261 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K +R++ ++NQKGGVGKTTTAINL TALAAIGE VL++D+DPQGNASTGLG+    R+ +
Sbjct: 6   KTARVLAVSNQKGGVGKTTTAINLGTALAAIGEKVLIVDMDPQGNASTGLGVPRETRRIT 65

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--- 120
            YD++++ ++++   + TA+P L IIP+  D+ G+E+ L     R +RL  AL+ Q    
Sbjct: 66  IYDVIVDGRSVHDAAVPTAVPGLHIIPADADMSGVEIELSQADRRSYRLRDALARQGEDG 125

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
           ++ + Y+ +DCPPS NLLT+NAMAAAD +LVPLQCEFFALEGL+QL++T+E VR+++N +
Sbjct: 126 SAGYDYVLIDCPPSLNLLTLNAMAAADGVLVPLQCEFFALEGLTQLMKTIEMVRQSLNPS 185

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L+IQG++LTM+D RN+LS QV +DVR + G KVY  VIPRNVR+SEAPS+GKP +IYDLK
Sbjct: 186 LEIQGLVLTMYDRRNALSGQVAADVRAHFGEKVYEAVIPRNVRVSEAPSFGKPVLIYDLK 245

Query: 241 CAGSQAYLKLASELIQQERHR 261
           C GSQAYL+LA E++ +ER R
Sbjct: 246 CTGSQAYLRLAKEVVGRERRR 266


>gi|170739703|ref|YP_001768358.1| cobyrinic acid ac-diamide synthase [Methylobacterium sp. 4-46]
 gi|168193977|gb|ACA15924.1| Cobyrinic acid ac-diamide synthase [Methylobacterium sp. 4-46]
          Length = 279

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 171/265 (64%), Positives = 209/265 (78%), Gaps = 6/265 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL TALAAIGE VL+IDLDPQGNASTGLGI+   R+ S+YD
Sbjct: 15  RIIALANQKGGVGKTTTAINLGTALAAIGEQVLIIDLDPQGNASTGLGIDRRQRRLSTYD 74

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L  E  + + +  TA+P ++I PSTMDLLG+EM +   +DR  RL + L      +   
Sbjct: 75  VLAGEAALKEAVQATAVPRVAIAPSTMDLLGLEMEMASAQDRAHRLRRVLEPLTRGEMAE 134

Query: 124 ---FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F+Y+ +DCPPS NLLT+NA+AAAD++LVPLQCEFFALEGLSQLL TVE+VR T+N  
Sbjct: 135 EERFTYVLIDCPPSLNLLTINALAAADAVLVPLQCEFFALEGLSQLLRTVEQVRGTLNPR 194

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L IQGI+LTMFD RN+LS QVV+DVR  +G KVY T+IPRNVR+SEAPS+GKP ++YDLK
Sbjct: 195 LAIQGIVLTMFDPRNNLSTQVVADVRAFMGDKVYETMIPRNVRVSEAPSHGKPVLLYDLK 254

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
           CAGSQAYL+LASE+IQ+E     AA
Sbjct: 255 CAGSQAYLRLASEIIQREGRLPAAA 279


>gi|83944972|ref|ZP_00957338.1| chromosome partitioning protein ParA [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851754|gb|EAP89609.1| chromosome partitioning protein ParA [Oceanicaulis alexandrii
           HTCC2633]
          Length = 278

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 158/264 (59%), Positives = 206/264 (78%), Gaps = 6/264 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTTAINL+TALAAIG+ V+++DLDPQGNASTGLG+   DR+ +SYD
Sbjct: 11  KVIAVANQKGGVGKTTTAINLATALAAIGQRVVVLDLDPQGNASTGLGVARADRRATSYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS------VQL 120
           +L+ E+ +   LI T +P L+IIPS +DL G E+ L     R +RL  A+         +
Sbjct: 71  VLVGERPLQDALIDTDVPGLAIIPSDVDLSGAELELSDAPRRSYRLRHAIDRFRRTLSGM 130

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
                YI +DCPPS NLLT+NAM AADS+LVPLQ EFFALEGL+QL+ T+E VR  +N +
Sbjct: 131 GEHCDYILIDCPPSLNLLTVNAMTAADSVLVPLQTEFFALEGLTQLMRTIELVRGNLNKS 190

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L+IQG++LTM+D RN+LS QV +DVR++ G KVYNTVIPRNVR+SEAPS+GKP ++YDL+
Sbjct: 191 LEIQGVVLTMYDRRNNLSSQVAADVREHFGDKVYNTVIPRNVRVSEAPSFGKPVLLYDLE 250

Query: 241 CAGSQAYLKLASELIQQERHRKEA 264
           CAG+QAYLKLASE+++QER   +A
Sbjct: 251 CAGAQAYLKLASEVVKQERRAADA 274


>gi|170750486|ref|YP_001756746.1| cobyrinic acid ac-diamide synthase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657008|gb|ACB26063.1| Cobyrinic acid ac-diamide synthase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 285

 Score =  333 bits (855), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 174/264 (65%), Positives = 211/264 (79%), Gaps = 6/264 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ +ANQKGGVGKTTTAINL TALAAIGE+VL+IDLDPQGNASTGLGI+   R+ S+Y+
Sbjct: 23  RVLALANQKGGVGKTTTAINLGTALAAIGEDVLVIDLDPQGNASTGLGIDRAKRRVSTYE 82

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT----- 121
           ++  E ++ Q ++ TA+P LS+ PSTMDLLG+E+ L    DR  RL   L   LT     
Sbjct: 83  VMAGEASLAQAVVPTAVPRLSLAPSTMDLLGLELELATLPDRAHRLRGVLK-SLTQAPSL 141

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           S  SY+ +DCPPS NLLT+NA+AAAD++LVPLQCEFFALEGLSQLL TVE+VR  +N  L
Sbjct: 142 SRISYVLIDCPPSLNLLTINALAAADAVLVPLQCEFFALEGLSQLLRTVEQVRGALNPKL 201

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            IQGI+LTMFD RN+LS QVV+DVR  +G KVY TVIPRNVRISEAPS+GKPA++YDLKC
Sbjct: 202 TIQGIVLTMFDPRNNLSAQVVADVRGFMGDKVYETVIPRNVRISEAPSHGKPALLYDLKC 261

Query: 242 AGSQAYLKLASELIQQERHRKEAA 265
           AGSQAYL+LASE+IQ+E     AA
Sbjct: 262 AGSQAYLRLASEVIQREGRVPAAA 285


>gi|254420635|ref|ZP_05034359.1| hypothetical protein BBAL3_2945 [Brevundimonas sp. BAL3]
 gi|196186812|gb|EDX81788.1| hypothetical protein BBAL3_2945 [Brevundimonas sp. BAL3]
          Length = 273

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 209/258 (81%), Gaps = 2/258 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R++ ++NQKGGVGKTTTAINL TALAAIG+ VL++D+DPQGNASTGLG+    R+ + Y
Sbjct: 11  ARVLAVSNQKGGVGKTTTAINLGTALAAIGKRVLIVDMDPQGNASTGLGVPRETRRVTIY 70

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ--LTSD 123
           D+++++++++   +QT +P L I+P+  D+ G+E+ L     R +RL  AL       + 
Sbjct: 71  DVVVDQRSVDDAAVQTTVPGLWIVPADADMSGVEIELSQADRRSYRLRDALRAHDHGPTA 130

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + Y+ +DCPPS NLLT+NAMAAAD++LVPLQCEFFALEGLSQL+ T++ V++++N AL+I
Sbjct: 131 YDYVLIDCPPSLNLLTLNAMAAADAVLVPLQCEFFALEGLSQLMRTIDMVKQSLNPALEI 190

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QG++LTM+D R++LS QV +DVR + G KVY++VIPRNVR++EAPS+GKPA+IYDLKCAG
Sbjct: 191 QGLVLTMYDRRSALSGQVANDVRAHFGDKVYDSVIPRNVRVAEAPSFGKPALIYDLKCAG 250

Query: 244 SQAYLKLASELIQQERHR 261
           SQAYL+LA E++++ER R
Sbjct: 251 SQAYLRLAKEVVKRERQR 268


>gi|295691567|ref|YP_003595260.1| cobyrinic acid ac-diamide synthase [Caulobacter segnis ATCC 21756]
 gi|295433470|gb|ADG12642.1| Cobyrinic acid ac-diamide synthase [Caulobacter segnis ATCC 21756]
          Length = 267

 Score =  332 bits (852), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 201/266 (75%), Gaps = 1/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M     R++ IANQKGGVGKTTTAINL TALAA GE VLLID DPQGN STGLGI    R
Sbjct: 1   MSANALRVLAIANQKGGVGKTTTAINLGTALAACGEKVLLIDADPQGNCSTGLGIGRTQR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQ 119
           + + YD+L+ E  +    ++T +P L +IP+  DL GIE+ LG    R +RL  AL +++
Sbjct: 61  RTTLYDVLMGESPVVDAAVRTELPGLDVIPADADLSGIEIELGQTARRSYRLRDALEAIR 120

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               ++Y+ +DCPPS N+LT+NAM AAD++ VPLQCEFFALEGL+QL+ T+E VR ++N 
Sbjct: 121 ANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNP 180

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L+IQG++LTM+D RNSLS+QV  DVR + G KVY+ VIPRNVR+SEAPS+GKP ++YDL
Sbjct: 181 HLEIQGVVLTMYDRRNSLSEQVAHDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDL 240

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYLKLA E+I +ER R+  A
Sbjct: 241 KCAGSQAYLKLAREVISRERDRQAKA 266


>gi|16127983|ref|NP_422547.1| chromosome partitioning protein ParA [Caulobacter crescentus CB15]
 gi|221236805|ref|YP_002519242.1| chromosome partitioning protein ParA [Caulobacter crescentus
           NA1000]
 gi|239977514|sp|B8GW31|PARA_CAUCN RecName: Full=Chromosome partitioning protein parA
 gi|239977515|sp|P0CAV7|PARA_CAUCR RecName: Full=Chromosome partitioning protein parA
 gi|13425527|gb|AAK25715.1| chromosome partitioning protein ParA [Caulobacter crescentus CB15]
 gi|220965978|gb|ACL97334.1| chromosome partitioning protein parA [Caulobacter crescentus
           NA1000]
          Length = 267

 Score =  331 bits (849), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 156/266 (58%), Positives = 201/266 (75%), Gaps = 1/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M     R++ IANQKGGVGKTTTAINL TALAA GE VLLID DPQGN STGLGI    R
Sbjct: 1   MSANPLRVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGIGRTQR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQ 119
           + + YD+L+ E  +    ++T +P L +IP+  DL G+E+ LG    R +RL  AL +++
Sbjct: 61  RTTLYDVLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIR 120

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               ++Y+ +DCPPS N+LT+NAM AAD++ VPLQCEFFALEGL+QL+ T+E VR ++N 
Sbjct: 121 ANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNP 180

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L+IQG++LTM+D RNSLS+QV  DVR + G KVY+ VIPRNVR+SEAPS+GKP ++YDL
Sbjct: 181 RLEIQGVVLTMYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDL 240

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYLKLA E+I +ER R+  A
Sbjct: 241 KCAGSQAYLKLAREVISRERDRQAKA 266


>gi|329847389|ref|ZP_08262417.1| chromosome partitioning protein parA [Asticcacaulis biprosthecum
           C19]
 gi|328842452|gb|EGF92021.1| chromosome partitioning protein parA [Asticcacaulis biprosthecum
           C19]
          Length = 262

 Score =  331 bits (849), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 157/260 (60%), Positives = 205/260 (78%), Gaps = 1/260 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ IANQKGGVGKTTTAINL TALAAIG  VLL+DLDPQGNASTGLG+   DR  S YD
Sbjct: 2   RVLAIANQKGGVGKTTTAINLGTALAAIGMRVLLVDLDPQGNASTGLGVPKVDRNSSLYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRL-DKALSVQLTSDFS 125
           +++++  I    ++T++P LS++PS  DL G+E+ LG  + R +RL D  L +  T  + 
Sbjct: 62  VIVDQCPIGDAAVKTSVPGLSLLPSDPDLSGVEIELGHAERRSYRLRDALLGLGETPVYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS NLLT+NAM+AAD++LVPLQCEFFALEGLSQL+ T++ VR ++N  L +QG
Sbjct: 122 YVLIDCPPSLNLLTVNAMSAADAVLVPLQCEFFALEGLSQLMRTIDLVRGSLNPRLSLQG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD RN+LS  V  DVR++ G  VY+TVIPRNVR+SEAPS+GKPA+IYD++C+GSQ
Sbjct: 182 IVLTMFDKRNALSGHVEKDVRQHFGHLVYDTVIPRNVRVSEAPSFGKPALIYDVRCSGSQ 241

Query: 246 AYLKLASELIQQERHRKEAA 265
           AY+KLA EL+ +E+ RK  A
Sbjct: 242 AYIKLAKELVAREKTRKPQA 261


>gi|114571500|ref|YP_758180.1| chromosome segregation ATPase [Maricaulis maris MCS10]
 gi|114341962|gb|ABI67242.1| chromosome segregation ATPase [Maricaulis maris MCS10]
          Length = 285

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 158/268 (58%), Positives = 200/268 (74%), Gaps = 6/268 (2%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  R+I +ANQKGGVGKTTTAINL TALAAI + V +IDLDPQGNASTGLG+    R  +
Sbjct: 13  KAPRVIAVANQKGGVGKTTTAINLGTALAAIKQKVAIIDLDPQGNASTGLGVPPAKRTLT 72

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--- 120
           SYD+L+   ++   +  T +P LSI+PS   L G E+ L  ++ R +RL +A+   +   
Sbjct: 73  SYDVLVGGDSLKSAMAPTVVPGLSIVPSDELLSGAELELADDQRRSYRLKRAIDQSMQAL 132

Query: 121 ---TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
               +   YI +DCPPS N+LT+N++ AADSILVPLQCEFFALEGLSQLL+TVE VR  +
Sbjct: 133 GPDAAGLDYILIDCPPSLNVLTVNSLTAADSILVPLQCEFFALEGLSQLLKTVERVRGHL 192

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           NS LDIQG++LTMFDSRN+LS +V +DVR++ G KVY TVIPRNVR+SEAPS GKP ++Y
Sbjct: 193 NSRLDIQGVVLTMFDSRNNLSAEVAADVREHFGDKVYKTVIPRNVRVSEAPSVGKPVLLY 252

Query: 238 DLKCAGSQAYLKLASELIQQERHRKEAA 265
           DL C+GSQAY+ LA E++QQER R   A
Sbjct: 253 DLHCSGSQAYISLAKEIVQQERKRHREA 280


>gi|167648981|ref|YP_001686644.1| cobyrinic acid ac-diamide synthase [Caulobacter sp. K31]
 gi|167351411|gb|ABZ74146.1| Cobyrinic acid ac-diamide synthase [Caulobacter sp. K31]
          Length = 270

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 153/256 (59%), Positives = 198/256 (77%), Gaps = 1/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ IANQKGGVGKTTTAINL TALAA GE VLLID DPQGN STGLGI    R+ + YD
Sbjct: 10  RVLAIANQKGGVGKTTTAINLGTALAACGERVLLIDADPQGNCSTGLGITRMQRRTTLYD 69

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLTSDFS 125
           +L+ EK +    ++T +P L +IP+  DL G+E+ LG    R +RL  AL  ++    ++
Sbjct: 70  VLMGEKPVVDAAVRTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEPLRANGPYT 129

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS N+LT+NAM AAD++ VPLQCEFFALEGL+QL+ T+E VR ++N  L+IQG
Sbjct: 130 YVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVRGSLNPKLEIQG 189

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RNSLS QV  DVR++ G KVY+ VIPRNVR+SEAPS+GKP ++YDLKCAGSQ
Sbjct: 190 VVLTMYDRRNSLSDQVARDVRQHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDLKCAGSQ 249

Query: 246 AYLKLASELIQQERHR 261
           AYL+LA E+I +E+ R
Sbjct: 250 AYLRLAREVITREKSR 265


>gi|83594956|ref|YP_428708.1| chromosome segregation ATPase [Rhodospirillum rubrum ATCC 11170]
 gi|83577870|gb|ABC24421.1| chromosome segregation ATPase [Rhodospirillum rubrum ATCC 11170]
          Length = 276

 Score =  325 bits (834), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 196/252 (77%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINL+TALAA G+ VL+ID+DPQGNASTGLG+    RK ++YD
Sbjct: 21  RIIAIANQKGGVGKTTTAINLATALAATGKRVLIIDMDPQGNASTGLGLSSAARKVTTYD 80

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ +      +  T IP L++IP+ +DL G E+ L     R FRL  AL+ +L  DF Y
Sbjct: 81  ILMGDAKARAAVTPTGIPRLAVIPAGVDLAGAELELVERTQREFRLRMALADELI-DFDY 139

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+  LLT+NA+ AAD+++VPLQCEFFALEG+S L++T++ VR+  N  L+IQGI
Sbjct: 140 VLVDCPPALGLLTLNALIAADAVMVPLQCEFFALEGVSHLVKTIDRVRKAFNPRLEIQGI 199

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN+LS+ V +DVR   G KVY TVIPRNVRISEAPS+GKP ++YDLKCAGSQA
Sbjct: 200 VLTMFDRRNNLSEMVAADVRDYFGAKVYKTVIPRNVRISEAPSHGKPVLLYDLKCAGSQA 259

Query: 247 YLKLASELIQQE 258
           YL LA E+I+QE
Sbjct: 260 YLHLAGEIIKQE 271


>gi|1916914|gb|AAB51267.1| ParA [Caulobacter crescentus CB15]
          Length = 266

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/266 (57%), Positives = 200/266 (75%), Gaps = 2/266 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M     R++ IANQKGGVGKTTTAINL TA A +GE VLLID DPQGN STGLGI    R
Sbjct: 1   MSANPLRVLAIANQKGGVGKTTTAINLGTAWA-LGERVLLIDADPQGNCSTGLGIGRTQR 59

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQ 119
           + + YD+L+ E  +    ++T +P L +IP+  DL G+E+ LG    R +RL  AL +++
Sbjct: 60  RTTLYDVLMGEAPVVDAAVKTELPGLDVIPADADLSGVEIELGQTARRSYRLRDALEAIR 119

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
               ++Y+ +DCPPS N+LT+NAM AAD++ VPLQCEFFALEGL+QL+ T+E V R++N 
Sbjct: 120 ANGPYTYVLIDCPPSLNVLTVNAMTAADAVFVPLQCEFFALEGLTQLMRTIERVARSLNP 179

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            L+IQG++LT++D RNSLS+QV  DVR + G KVY+ VIPRNVR+SEAPS+GKP ++YDL
Sbjct: 180 RLEIQGVVLTIYDRRNSLSEQVAKDVRAHFGDKVYDAVIPRNVRVSEAPSFGKPVLLYDL 239

Query: 240 KCAGSQAYLKLASELIQQERHRKEAA 265
           KCAGSQAYLKLA E+I +ER R+  A
Sbjct: 240 KCAGSQAYLKLAREVISRERDRQAKA 265


>gi|144899659|emb|CAM76523.1| Cobyrinic acid a,c-diamide synthase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 267

 Score =  315 bits (807), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 153/256 (59%), Positives = 196/256 (76%), Gaps = 1/256 (0%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           +K +R+I IANQKGGVGKTTTAINL+TA+AA  + VLLIDLDPQGNASTGLGI    R  
Sbjct: 6   KKPTRVIAIANQKGGVGKTTTAINLATAMAATKKTVLLIDLDPQGNASTGLGIARDARDV 65

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
           +SY +LI E  + +    T IP L I+PS +DL G E+ L     R  RL +AL   L  
Sbjct: 66  NSYHVLIGEAGLAETTHDTEIPGLKIVPSGVDLSGAEIELVDMARREVRLSEALKPAL-G 124

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + Y+ +DCPPS NLLT+NA+ AA+S+LVPLQCEFFALEG+S L++T+E +R+  N  L+
Sbjct: 125 VYDYVLIDCPPSLNLLTLNALVAANSVLVPLQCEFFALEGISHLVKTIEAIRKGFNPTLE 184

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           +QGI+LTMFD RN+L++QV +DVR+  G KVY TVIPRNVRISEAPSYGKP +IYD KCA
Sbjct: 185 LQGIVLTMFDKRNNLTEQVAADVREFFGEKVYKTVIPRNVRISEAPSYGKPVLIYDHKCA 244

Query: 243 GSQAYLKLASELIQQE 258
           GS+AY+ LA+E++++E
Sbjct: 245 GSEAYIHLAAEVLKRE 260


>gi|83309103|ref|YP_419367.1| chromosome partitioning ATPase [Magnetospirillum magneticum AMB-1]
 gi|82943944|dbj|BAE48808.1| ATPase involved in chromosome partitioning [Magnetospirillum
           magneticum AMB-1]
          Length = 265

 Score =  315 bits (806), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 200/254 (78%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I +ANQKGGVGKTTTAINL+TA+AA  + VL+IDLDPQGNASTGLGI+   R  +SY
Sbjct: 9   ARVIAVANQKGGVGKTTTAINLATAMAATKKTVLIIDLDPQGNASTGLGIDRSARDVNSY 68

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI E  +   ++ T+IP LS++PS +DL G E+ L   + R  RL ++L+  L + + 
Sbjct: 69  HVLIGEAALADAVLTTSIPGLSLVPSGVDLSGAEIELVEFERREHRLKESLAGSLGA-YD 127

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS NLLT+NA+ AA++++VPLQCEFFALEG+S L++T+E VR+  N  L++QG
Sbjct: 128 YVLIDCPPSLNLLTLNALVAANAVMVPLQCEFFALEGVSHLIKTIERVRQAFNPQLELQG 187

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTMFD RN+LS QV +DVR   G KVY TVIPRNVR+SEAPS+GKP ++YD+KC GS+
Sbjct: 188 IILTMFDKRNNLSDQVAADVRDYFGDKVYKTVIPRNVRVSEAPSHGKPVLLYDMKCTGSE 247

Query: 246 AYLKLASELIQQER 259
           AY+ LASE++++ER
Sbjct: 248 AYISLASEVLKRER 261


>gi|163796495|ref|ZP_02190455.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
 gi|159178345|gb|EDP62889.1| ATPase involved in chromosome partitioning [alpha proteobacterium
           BAL199]
          Length = 263

 Score =  314 bits (805), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 150/260 (57%), Positives = 197/260 (75%), Gaps = 1/260 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ I NQKGGVGKTTTA+NL+TA+AA  + VL++DLDPQGNASTG G+    R   SY 
Sbjct: 4   RILAIVNQKGGVGKTTTAVNLATAMAACQKRVLVVDLDPQGNASTGFGVPRKARDADSYA 63

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT-SDFS 125
           +LI E +I    IQT +P L ++P++ +L G E+ L   + R FRL +AL      S + 
Sbjct: 64  VLIGEASIADAAIQTEVPGLEVVPASPNLSGAEIELVTMEHREFRLREALVRHAAASPYD 123

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+D++LVPLQCEF+ALEGLSQL+ TVE VR+++N  L+IQG
Sbjct: 124 YILIDCPPSLGLLTLNALVASDAVLVPLQCEFYALEGLSQLIRTVERVRKSLNPDLEIQG 183

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD RN+LS+QV +DVR + G  VY TVIPRNVR+SEAPSYGKP I+YD+ C+GS+
Sbjct: 184 VVLTMFDRRNNLSEQVAADVRGHFGDVVYRTVIPRNVRVSEAPSYGKPVIVYDMACSGSR 243

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E++++ER   EAA
Sbjct: 244 AYLDLAREVLRRERALAEAA 263


>gi|114798917|ref|YP_762232.1| chromosome partitioning protein ParA [Hyphomonas neptunium ATCC
           15444]
 gi|114739091|gb|ABI77216.1| chromosome partitioning protein ParA [Hyphomonas neptunium ATCC
           15444]
          Length = 268

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 195/264 (73%), Gaps = 7/264 (2%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RI  + NQKGGVGKTTT+INL TALAA+G  VL++D D QGNASTGLGI   +R  +S
Sbjct: 3   RPRIFAVVNQKGGVGKTTTSINLGTALAAVGRRVLIVDFDAQGNASTGLGISRAERLMTS 62

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS-- 122
           YDL+++   + + ++ T +P L I+P   +L G+E  L G+  R +RL ++L   +    
Sbjct: 63  YDLVVDRVPLEEAVLSTIVPRLDIVPGDENLSGVETELAGDAHRSYRLKESLHSYIDRVE 122

Query: 123 -----DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
                 + Y+ +DCPPS + LTMNAM AAD++LVPLQCEF ALEGL+QLL TVE VR  +
Sbjct: 123 QGGLVKYDYVLIDCPPSLSALTMNAMTAADALLVPLQCEFLALEGLTQLLRTVEVVRSGL 182

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           N  L+IQG++LTM+D RNSLS QV ++VR   G KVYNTVIPRNVR+SEAPS+GKPA++Y
Sbjct: 183 NPTLEIQGVVLTMYDRRNSLSDQVANEVRAFFGTKVYNTVIPRNVRLSEAPSFGKPALLY 242

Query: 238 DLKCAGSQAYLKLASELIQQERHR 261
           D +C GS+AY++LASE++Q+ER R
Sbjct: 243 DYRCPGSEAYIRLASEVLQRERAR 266


>gi|288956855|ref|YP_003447196.1| chromosome partitioning protein [Azospirillum sp. B510]
 gi|288909163|dbj|BAI70652.1| chromosome partitioning protein [Azospirillum sp. B510]
          Length = 265

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 142/254 (55%), Positives = 196/254 (77%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R++ IANQKGGVGKTTT INL+TALA IG+ VL+IDLDPQGNASTGLGI   DR+   Y
Sbjct: 9   ARVVAIANQKGGVGKTTTTINLATALAVIGKRVLVIDLDPQGNASTGLGIPRSDRRVGIY 68

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L ++ ++      +++PNLSII S++DL G E+ L G + R FRL +A++     ++ 
Sbjct: 69  DVLFDDVSLEDAATASSVPNLSIITSSVDLSGAEIELVGAERREFRLREAVA-NSALEYD 127

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPP+  LLT+NA+ A+ +++VPLQCEF+ALEGLS L+ T+E V+R  N  LDI G
Sbjct: 128 YVLIDCPPALGLLTLNALVASHAVMVPLQCEFYALEGLSHLVRTIERVKRAFNPNLDIHG 187

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD RN+LS  V +DVR   G KVY+TVIPRNV++SEAPS+GKP +IYD++C GSQ
Sbjct: 188 VVLTMFDKRNNLSDMVAADVRGFFGEKVYDTVIPRNVKVSEAPSHGKPVLIYDMRCPGSQ 247

Query: 246 AYLKLASELIQQER 259
           AY+ LA E++++E+
Sbjct: 248 AYIHLAGEVLRREK 261


>gi|254292379|ref|YP_003058402.1| cobyrinic acid ac-diamide synthase [Hirschia baltica ATCC 49814]
 gi|254040910|gb|ACT57705.1| Cobyrinic acid ac-diamide synthase [Hirschia baltica ATCC 49814]
          Length = 266

 Score =  308 bits (789), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 149/263 (56%), Positives = 190/263 (72%), Gaps = 7/263 (2%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII +ANQKGGVGKTTT+INL TALAA G  VLLID DPQGNASTGLGI   +R  +SY
Sbjct: 3   TRIIAVANQKGGVGKTTTSINLGTALAAAGRKVLLIDFDPQGNASTGLGIPPSERDLTSY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--- 122
           D++I+   I     +T IP L IIP   +L G+E  L  +  R +R   A+     +   
Sbjct: 63  DVVIDGAEIRAACKETVIPRLHIIPGDENLSGVETKLSDDPRRSYRFKDAMDAYRDAAAN 122

Query: 123 ----DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
               ++ ++ +DCPPS + LT+NAM   D++LVPLQCEFFA+EGLSQLL TVE VR  +N
Sbjct: 123 GECDEYDFVLIDCPPSLSSLTINAMTGCDAVLVPLQCEFFAMEGLSQLLRTVEVVRGALN 182

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
           + L+IQGI+LTM+D R + S QV +DVR   G KVY TVIPRNVR+SEAP +GKPA++YD
Sbjct: 183 AELEIQGIVLTMYDKRQAQSAQVEADVRSFFGSKVYETVIPRNVRLSEAPGFGKPALLYD 242

Query: 239 LKCAGSQAYLKLASELIQQERHR 261
            KC+GS+AY+KLASE+IQ+ER R
Sbjct: 243 HKCSGSEAYIKLASEVIQRERER 265


>gi|300024786|ref|YP_003757397.1| cobyrinic acid ac-diamide synthase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526607|gb|ADJ25076.1| Cobyrinic acid ac-diamide synthase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 282

 Score =  307 bits (787), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 144/267 (53%), Positives = 203/267 (76%), Gaps = 9/267 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R++ IANQKGGVGKTTTAINL TALAA+GE VL++DLD QGNASTGLGI+   R  +S+D
Sbjct: 16  RVVAIANQKGGVGKTTTAINLGTALAAVGERVLVLDLDSQGNASTGLGIDPESRFKTSFD 75

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGE-KDRLFRLDKALSVQL----- 120
           +L    +I   +++TA+PNL ++P+  DL+GI+  L G+ + R F+L  A++  +     
Sbjct: 76  ILTGAASILDTVLKTAVPNLFVVPANSDLVGIDTALAGDPQTRPFKLRDAVTALVGQQRN 135

Query: 121 ---TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTV 177
               + FSY+ +DCPPS N+LT+NAM AA ++LVP+QCEFFALEG+SQL +++E++R ++
Sbjct: 136 RPADTHFSYVLIDCPPSLNVLTLNAMTAAHAVLVPVQCEFFALEGISQLKDSIEQIRASL 195

Query: 178 NSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIY 237
           N  L+IQG++LTM D R SLS++V  +VR   G KVY TVIPRN R++EAPS+GKP ++Y
Sbjct: 196 NPRLEIQGVVLTMHDQRTSLSREVADNVRAFFGPKVYETVIPRNTRVAEAPSHGKPLLLY 255

Query: 238 DLKCAGSQAYLKLASELIQQERHRKEA 264
           D  CAGSQAY++LA+E+I++E+  K A
Sbjct: 256 DYDCAGSQAYIRLATEIIEREKRFKAA 282


>gi|89052693|ref|YP_508144.1| chromosome segregation ATPase [Jannaschia sp. CCS1]
 gi|88862242|gb|ABD53119.1| chromosome segregation ATPase [Jannaschia sp. CCS1]
          Length = 259

 Score =  307 bits (787), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 152/259 (58%), Positives = 195/259 (75%), Gaps = 1/259 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+++I NQKGGVGKTTTAINL  ALAA G+ VL++DLDPQGNASTGLGIE   R  ++YD
Sbjct: 2   RVLSITNQKGGVGKTTTAINLGAALAATGKFVLIVDLDPQGNASTGLGIEARSRSKTTYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI+   +  + I T I NLSI P+T DL   ++ LG   +R+F L +ALS  + + + Y
Sbjct: 62  LLIDGAALEDVSIPTEIANLSIAPATTDLSSTDVELGQRDNRIFLLKEALSESIDT-YDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS +LLT+NA+ A+D++LVPLQ EFFALEGLSQL+ TV EVR T N +L I+G+
Sbjct: 121 VLIDCPPSLSLLTLNALVASDALLVPLQAEFFALEGLSQLMLTVREVRETANPSLRIEGV 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+RN LS+QV  D R NLG  V+NT+IPRNVR+SEAPS+  PAI+YD    GSQA
Sbjct: 181 VLTMHDARNRLSRQVEDDARSNLGELVFNTMIPRNVRLSEAPSFALPAIVYDPMSKGSQA 240

Query: 247 YLKLASELIQQERHRKEAA 265
           YL LA ELI +E  R+EA+
Sbjct: 241 YLDLAEELIDRETPRQEAS 259


>gi|73667541|ref|YP_303557.1| chromosome segregation ATPase [Ehrlichia canis str. Jake]
 gi|72394682|gb|AAZ68959.1| chromosome segregation ATPase [Ehrlichia canis str. Jake]
          Length = 255

 Score =  306 bits (783), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 193/254 (75%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++  I NQKGGVGKTTT+INLSTA + + +  LLIDLDPQGN+STG GI    R  + Y
Sbjct: 2   SKVFAIVNQKGGVGKTTTSINLSTAFSIVNKKTLLIDLDPQGNSSTGFGITYEQRTNTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI    I+  ++ T IPNL ++PST+DL   E+ L   + R F L K+LS ++ + + 
Sbjct: 62  EVLINNLPISSAVVTTEIPNLHLLPSTVDLSAAEVELTQVQQREFILKKSLS-EVKNSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AADSI++PLQCEFFALEGLS L++T+E V++ +N  L I+G
Sbjct: 121 YIFIDCPPSLGLLTVNALIAADSIMIPLQCEFFALEGLSHLIKTIEIVKKHLNPLLSIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTM+D RN LS+QV  D+RK L   VY TVIPRNVR+SEAPS+GKPAIIYD KCAGSQ
Sbjct: 181 IILTMYDKRNKLSEQVEEDIRKYLKESVYKTVIPRNVRLSEAPSHGKPAIIYDFKCAGSQ 240

Query: 246 AYLKLASELIQQER 259
           AY+ LA E++++++
Sbjct: 241 AYIYLAKEILKKQK 254


>gi|68171523|ref|ZP_00544903.1| Cobyrinic acid a,c-diamide synthase [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88657765|ref|YP_507940.1| ParA family chromosome partitioning ATPase [Ehrlichia chaffeensis
           str. Arkansas]
 gi|67999051|gb|EAM85722.1| Cobyrinic acid a,c-diamide synthase [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599222|gb|ABD44691.1| chromosome partitioning ATPase, ParA family [Ehrlichia chaffeensis
           str. Arkansas]
          Length = 256

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/254 (57%), Positives = 193/254 (75%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+   I NQKGGVGKTTT+INLSTA A + +  LLIDLDPQGN+STG GI    R  + Y
Sbjct: 2   SKAFAIVNQKGGVGKTTTSINLSTAFAIVNKKTLLIDLDPQGNSSTGFGITYEQRINTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+    I+  +I+T IPNL ++PST+DL   E+ L   + R F L K+LS ++ + + 
Sbjct: 62  EVLVNNLPISSTIIKTEIPNLHLLPSTVDLSAAEIELTQVQQREFILKKSLS-EVKNSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AADSI++PLQCEFFALEGLS L++T+E V++ +N  L I+G
Sbjct: 121 YIFIDCPPSLGLLTVNALIAADSIIIPLQCEFFALEGLSHLMKTIEIVKKHLNPLLSIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTM+D RN LS+QV  D+RK L   VY TVIPRNVR+SEAPS+GKPAIIYD KCAGSQ
Sbjct: 181 IILTMYDKRNKLSEQVEEDIRKYLKESVYKTVIPRNVRLSEAPSHGKPAIIYDFKCAGSQ 240

Query: 246 AYLKLASELIQQER 259
           AY+ LA E++++++
Sbjct: 241 AYIYLAKEILRKQK 254


>gi|304320462|ref|YP_003854105.1| chromosome partitioning protein A [Parvularcula bermudensis
           HTCC2503]
 gi|303299364|gb|ADM08963.1| chromosome partitioning protein A [Parvularcula bermudensis
           HTCC2503]
          Length = 246

 Score =  303 bits (777), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 192/244 (78%), Gaps = 2/244 (0%)

Query: 18  VGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQI 77
           +GKTTT INL TALAA+GE VLLIDLDPQGNASTGLGI    R+ ++YD+L+E  ++ QI
Sbjct: 1   MGKTTTTINLGTALAAVGEKVLLIDLDPQGNASTGLGIGPALREQTTYDVLMERVDLAQI 60

Query: 78  LIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--FSYIFLDCPPSF 135
             ++ +PNL++ P+ MDL G E+ L     R +RL  A+   +  D   +YI +DCPPS 
Sbjct: 61  AHKSIVPNLTVAPAGMDLAGAEVELIETPRRHYRLANAIEKAVEQDPALTYILVDCPPSL 120

Query: 136 NLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRN 195
            LLT+NAMAAA ++++PLQCEFFALEGL+Q++ T+ +VR  +N  L++QG+ILTM+D RN
Sbjct: 121 GLLTVNAMAAAHAVMIPLQCEFFALEGLAQIMRTISQVRTRLNPHLELQGVILTMYDKRN 180

Query: 196 SLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELI 255
           +LS++V ++VR+NLG KVY T IPRNVRISEAPS+GKPA++YDLKC GSQAY++LA+E+I
Sbjct: 181 NLSREVEANVRENLGEKVYKTAIPRNVRISEAPSHGKPALLYDLKCPGSQAYVRLATEVI 240

Query: 256 QQER 259
            +ER
Sbjct: 241 HRER 244


>gi|332187052|ref|ZP_08388793.1| cobQ/CobB/MinD/ParA nucleotide binding domain protein [Sphingomonas
           sp. S17]
 gi|332013062|gb|EGI55126.1| cobQ/CobB/MinD/ParA nucleotide binding domain protein [Sphingomonas
           sp. S17]
          Length = 263

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 149/249 (59%), Positives = 185/249 (74%), Gaps = 1/249 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           + IANQKGGVGKTT+AINL+TALAA G  VLLIDLDPQGNASTGLGI    R +SSY +L
Sbjct: 4   VAIANQKGGVGKTTSAINLATALAATGLQVLLIDLDPQGNASTGLGIPNSQRVFSSYHVL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           + E  I+  ++ T +P L I+P+T+DL G E+ L   +DR  RLD A+  +    +  + 
Sbjct: 64  LGEARIDDAVVHTQVPRLDIVPATVDLSGAELELVDFEDRTHRLDHAMR-RSQGRWDIVL 122

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NAM A+DS+ VPLQCEFFALEGLSQLL TVE +R   N  L I G+ L
Sbjct: 123 IDCPPSLGLLTINAMVASDSLFVPLQCEFFALEGLSQLLTTVERIRARFNPGLAILGVAL 182

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L+ QV +DVR  LGG V++TVIPRNVR+SEAPS+G PA+IYD +C GSQAY+
Sbjct: 183 TMYDRRNRLTDQVSADVRAVLGGVVFDTVIPRNVRLSEAPSHGLPALIYDHRCVGSQAYI 242

Query: 249 KLASELIQQ 257
            LA ELI +
Sbjct: 243 ALARELIAR 251


>gi|307297007|ref|ZP_07576823.1| chromosome partitioning protein ParA [Sphingobium chlorophenolicum
           L-1]
 gi|306877533|gb|EFN08761.1| chromosome partitioning protein ParA [Sphingobium chlorophenolicum
           L-1]
          Length = 260

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 187/257 (72%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAINL+T LAA G  VLL+DLDPQGNASTGLG+   DR+ SSYDLL
Sbjct: 4   IAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNASTGLGVNQSDREQSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           +    +   +I T +P L I+P+T DL G E+ L   ++R  RL++ LS      +    
Sbjct: 64  MGHCALEDAIITTRVPKLDIVPATQDLSGAEIELIEYEERTHRLERVLSEAQPGRWDICL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NAM AA S+LVPLQCEFFALEGLSQLL+TVE +R   N  L I G+ L
Sbjct: 124 IDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQTVERIRGRFNPGLSIMGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L+ QV  DVR  LG  V++TVIPRNVR+SEAPS+G PA+IYD +C+GS+AY+
Sbjct: 184 TMYDRRNRLTDQVADDVRACLGDLVFSTVIPRNVRLSEAPSHGVPALIYDFRCSGSEAYM 243

Query: 249 KLASELIQQERHRKEAA 265
           +LA ELI +   ++ AA
Sbjct: 244 RLARELIARLPRQEVAA 260


>gi|87198160|ref|YP_495417.1| chromosome segregation ATPase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87133841|gb|ABD24583.1| chromosome segregation ATPase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 258

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 153/257 (59%), Positives = 188/257 (73%), Gaps = 2/257 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           + +ANQKGGVGKTTTAIN++TALAA G   LLIDLDPQGN STG+GI   +R+ SSYDLL
Sbjct: 4   VAVANQKGGVGKTTTAINIATALAATGWKSLLIDLDPQGNCSTGIGIPAGERERSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           I++ +I + ++ T IP L I+P+T+DL G E+ L   +DR  RL   L+     D   I 
Sbjct: 64  IDQASIAECMMPTRIPGLDIVPATVDLSGAEVELVSVEDRTHRLRNVLNADTGHDICLI- 122

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
            DCPPS  LLT+NA+ AAD+ILVPLQCEFFALEGLSQLL+TVE V+   N  L I GI+L
Sbjct: 123 -DCPPSLGLLTLNALTAADTILVPLQCEFFALEGLSQLLQTVERVQERFNPDLGILGIVL 181

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TMFD RN L+ QV  DVR  L   V++ VIPRNVR+SEAPS+G PA+IYD  C GSQAY+
Sbjct: 182 TMFDRRNRLTDQVADDVRSCLRDLVFDAVIPRNVRLSEAPSHGLPALIYDHACPGSQAYM 241

Query: 249 KLASELIQQERHRKEAA 265
           KLA ELI +   R++AA
Sbjct: 242 KLARELIGRLPERRKAA 258


>gi|85709799|ref|ZP_01040864.1| chromosome partitioning protein ATPase component [Erythrobacter sp.
           NAP1]
 gi|85688509|gb|EAQ28513.1| chromosome partitioning protein ATPase component [Erythrobacter sp.
           NAP1]
          Length = 280

 Score =  301 bits (772), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 191/257 (74%), Gaps = 2/257 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAIN++TA+AA G   LLIDLDPQGNASTGLG+    R  SSYDLL
Sbjct: 26  IAIANQKGGVGKTTTAINMATAMAATGWRTLLIDLDPQGNASTGLGVGADARDISSYDLL 85

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           ++E  +   ++ T+IP L I+P+T+DL G E+ L   ++R  RL  ALS          F
Sbjct: 86  VDEVPLVDSIVPTSIPGLDIVPATVDLSGAEVELVSVEERTARLRTALSNH--GGHEVCF 143

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AAD+++VPLQCEFFALEGLSQLL+TVE+V++  N  LDI G++L
Sbjct: 144 IDCPPSLGLLTLNALCAADTLMVPLQCEFFALEGLSQLLKTVEQVQQRFNPTLDIIGVVL 203

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L+ QV  DVR  LGG V+ TVIPRNVR+SEAPS+G PA++YD  CAGS+AY+
Sbjct: 204 TMYDRRNRLTDQVSEDVRDCLGGLVFETVIPRNVRLSEAPSHGLPALVYDHSCAGSRAYI 263

Query: 249 KLASELIQQERHRKEAA 265
            LA ELI +    ++AA
Sbjct: 264 ALARELIGRFPPERKAA 280


>gi|294010013|ref|YP_003543473.1| chromosome partitioning protein ParA [Sphingobium japonicum UT26S]
 gi|292673343|dbj|BAI94861.1| chromosome partitioning protein ParA [Sphingobium japonicum UT26S]
          Length = 260

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 149/257 (57%), Positives = 187/257 (72%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAINL+T LAA G  VLL+DLDPQGNASTGLG+   DR+ SSYDLL
Sbjct: 4   IAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNASTGLGVNQSDREQSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           +    +   +I T +P L I+P+T DL G E+ L   ++R  RL++ L+      +    
Sbjct: 64  VGNCALEDAIISTRVPKLDIVPATQDLSGAEIELIEYEERTHRLERVLAEAQPGRWDICL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NAM AA S+LVPLQCEFFALEGLSQLL+TVE +R   N  L I G+ L
Sbjct: 124 IDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQTVERIRGRFNPGLSIMGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L+ QV  DVR  LG  V++TVIPRNVR+SEAPS+G PA+IYD +C+GS+AY+
Sbjct: 184 TMYDRRNRLTDQVADDVRACLGDLVFSTVIPRNVRLSEAPSHGVPALIYDFRCSGSEAYM 243

Query: 249 KLASELIQQERHRKEAA 265
           +LA ELI +   ++ AA
Sbjct: 244 RLARELIARLPRQEVAA 260


>gi|149185271|ref|ZP_01863588.1| chromosome partitioning protein ATPase component [Erythrobacter sp.
           SD-21]
 gi|148831382|gb|EDL49816.1| chromosome partitioning protein ATPase component [Erythrobacter sp.
           SD-21]
          Length = 262

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/259 (58%), Positives = 190/259 (73%), Gaps = 2/259 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAIN++TA+AA G   LLIDLDPQGNASTGLGI+   R+Y++YDLL
Sbjct: 4   IAIANQKGGVGKTTTAINIATAMAASGWKTLLIDLDPQGNASTGLGIDNASREYTTYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT--SDFSY 126
           + +  + Q   +T IP+L I+P+T DL G E+ L   +DR  RL K L+   T  + +  
Sbjct: 64  LGDATLAQAAQKTEIPSLDIVPATQDLSGAEVELVSVEDRTHRLQKTLTAPQTGFAGYDV 123

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
            F+DCPPS  LLT+NA+ AAD+++VPLQCEFFALEGLSQLL+TVE V++  N  L I GI
Sbjct: 124 AFIDCPPSLGLLTLNALGAADTLMVPLQCEFFALEGLSQLLQTVERVQQRFNPDLGIVGI 183

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
            LTMFD RN L+ QV  DVR  LG  V+  VIPRNVR+SEAPS+G PA+IYD  C GS+A
Sbjct: 184 ALTMFDRRNKLTDQVADDVRDCLGNLVFENVIPRNVRLSEAPSHGMPALIYDHNCPGSRA 243

Query: 247 YLKLASELIQQERHRKEAA 265
           Y+ LA ELI +   +++AA
Sbjct: 244 YIGLARELIGRLPEKRKAA 262


>gi|163732966|ref|ZP_02140410.1| chromosome partitioning protein ParA [Roseobacter litoralis Och
           149]
 gi|161393501|gb|EDQ17826.1| chromosome partitioning protein ParA [Roseobacter litoralis Och
           149]
          Length = 269

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 187/255 (73%), Gaps = 2/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT INL+ ALA  G  VL++DLDPQGNASTGLGIE+ DRKY++YD
Sbjct: 11  KIIAVANQKGGVGKTTTTINLAAALAEAGRRVLVVDLDPQGNASTGLGIEVEDRKYTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS- 125
           +L+ + +I  +++QT  PNL I+P+T+DL   ++ L   + R F L  AL      DF  
Sbjct: 71  ILLGDVDIKAVVLQTVTPNLLIVPATVDLSSADLELMSSEKRSFLLHDALRQIQMDDFGL 130

Query: 126 -YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L I+
Sbjct: 131 DYVLIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTGNKDLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D RN+LS QV  D R NLG  V+NT IPRNVR+SEAPS+  P + YD    G+
Sbjct: 191 GILLTMYDKRNNLSLQVEQDARDNLGDMVFNTRIPRNVRVSEAPSFAMPVLTYDTLSKGA 250

Query: 245 QAYLKLASELIQQER 259
           QAY  LA ELIQ+ R
Sbjct: 251 QAYRALAKELIQKNR 265


>gi|85375440|ref|YP_459502.1| chromosome partitioning protein ATPase component [Erythrobacter
           litoralis HTCC2594]
 gi|84788523|gb|ABC64705.1| chromosome partitioning protein ATPase component [Erythrobacter
           litoralis HTCC2594]
          Length = 258

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 188/257 (73%), Gaps = 2/257 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAIN++TA+AA G   LLIDLDPQGNASTG+GI+  DR+ SSYDLL
Sbjct: 4   IAIANQKGGVGKTTTAINIATAMAAAGWKTLLIDLDPQGNASTGMGIDAEDRENSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           +++  +   +  T+IP L I+P+T DL G E+ L    DR  RL  AL+    +D    F
Sbjct: 64  VDQYPLADCISPTSIPGLDIVPATQDLSGAEVELVSVDDRTDRLRSALAGH--TDHQICF 121

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AAD++LVPLQCEFFALEGLSQLL+TVE V++  N  L I G+ L
Sbjct: 122 IDCPPSLGLLTLNALGAADTLLVPLQCEFFALEGLSQLLQTVERVQQRFNPDLGIIGVAL 181

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TMFD RN L+ QV  DVR  LG  V+  VIPRNVR+SEAPS+G PA++YD  CAGS+AY+
Sbjct: 182 TMFDRRNRLTDQVADDVRDCLGDLVFQAVIPRNVRLSEAPSHGLPALVYDHSCAGSRAYM 241

Query: 249 KLASELIQQERHRKEAA 265
            LA ELI +    ++AA
Sbjct: 242 ALARELIGRLPEERKAA 258


>gi|58579598|ref|YP_197810.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium
           str. Welgevonden]
 gi|58418224|emb|CAI27428.1| Sporulation initiation inhibitor protein soj [Ehrlichia ruminantium
           str. Welgevonden]
          Length = 260

 Score =  299 bits (766), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++  I NQKGGVGKTTT+INL+TA A + +  LLIDLDPQGN+STG GI    R  + Y
Sbjct: 7   SKVFGIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVY 66

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI     +  +I+T IPNL ++PST+DL   E+ L   + R F L  +LS ++ + + 
Sbjct: 67  EVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSLS-EIKTSYD 125

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AA+++++PLQCEFFALEGLS L++T+E +++ +N +L I+G
Sbjct: 126 YIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEG 185

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTM+D RN LS+QV  D+RK L   VY TVIPRNVR+SEAPS+GKPAIIYD KCAGSQ
Sbjct: 186 IILTMYDKRNKLSEQVEEDIRKYLKESVYKTVIPRNVRLSEAPSHGKPAIIYDFKCAGSQ 245

Query: 246 AYLKLASELIQQERH 260
           AY+ LA E+++++++
Sbjct: 246 AYIYLAKEILKRQQN 260


>gi|103488333|ref|YP_617894.1| cobyrinic acid a,c-diamide synthase [Sphingopyxis alaskensis
           RB2256]
 gi|98978410|gb|ABF54561.1| chromosome segregation ATPase [Sphingopyxis alaskensis RB2256]
          Length = 260

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 151/257 (58%), Positives = 188/257 (73%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I +ANQKGGVGKTTTAINL+TALAA G   L+IDLDPQGNASTGLGI+   R+ SSY+LL
Sbjct: 4   IAVANQKGGVGKTTTAINLATALAATGWRTLIIDLDPQGNASTGLGIKQSQRECSSYELL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
             +  + +  I TA+P L I+ +T+DL G E+ L   +DRL RL KALS      +    
Sbjct: 64  RGDAGVAECAIPTAVPRLDIVSATVDLSGAEIELIEYQDRLHRLQKALSGAEAGQWDICL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  +LT+NA+ AA+S++VPLQCEFFALEGLSQLL TVE VR   N  L I G+ L
Sbjct: 124 IDCPPSLGMLTLNALIAAESLIVPLQCEFFALEGLSQLLTTVERVRERFNQKLSILGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TMFD RN L+ QV  DVR+ LG  V++TVIPRNVR+SEAPS+G PA+IYD +CAGS AY+
Sbjct: 184 TMFDRRNRLTDQVSDDVREVLGPVVFDTVIPRNVRLSEAPSHGLPALIYDHRCAGSAAYI 243

Query: 249 KLASELIQQERHRKEAA 265
            LA E+I +    ++AA
Sbjct: 244 ALAREMIDRLPEIRKAA 260


>gi|57239609|ref|YP_180745.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium
           str. Welgevonden]
 gi|57161688|emb|CAH58618.1| chromosome partitioning protein ParA [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 255

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++  I NQKGGVGKTTT+INL+TA A + +  LLIDLDPQGN+STG GI    R  + Y
Sbjct: 2   SKVFGIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI     +  +I+T IPNL ++PST+DL   E+ L   + R F L  +LS ++ + + 
Sbjct: 62  EVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSLS-EIKTSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AA+++++PLQCEFFALEGLS L++T+E +++ +N +L I+G
Sbjct: 121 YIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTM+D RN LS+QV  D+RK L   VY TVIPRNVR+SEAPS+GKPAIIYD KCAGSQ
Sbjct: 181 IILTMYDKRNKLSEQVEEDIRKYLKESVYKTVIPRNVRLSEAPSHGKPAIIYDFKCAGSQ 240

Query: 246 AYLKLASELIQQERH 260
           AY+ LA E+++++++
Sbjct: 241 AYIYLAKEILKRQQN 255


>gi|326404879|ref|YP_004284961.1| chromosome partitioning protein ParA [Acidiphilium multivorum
           AIU301]
 gi|325051741|dbj|BAJ82079.1| chromosome partitioning protein ParA [Acidiphilium multivorum
           AIU301]
          Length = 263

 Score =  298 bits (762), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 138/256 (53%), Positives = 189/256 (73%), Gaps = 1/256 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + +II IANQKGGVGKTTTAINL+TALAA GE VLLIDLDPQGNASTG GI   +R   S
Sbjct: 2   QPKIIAIANQKGGVGKTTTAINLATALAATGERVLLIDLDPQGNASTGFGIGTDERGIGS 61

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLTSD 123
           Y L+  E     +++ T +P L IIP+T DL+G ++   G + R   + +AL    L   
Sbjct: 62  YALMTGEAPAASLVLPTEVPGLLIIPATEDLIGADIEFAGAEGREHLVRRALGEPGLAGQ 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F Y+F+DCPP   LLT+NA+ AA S+L+PLQCEFFALEG+SQL+ T++ VR ++N  L +
Sbjct: 122 FGYVFIDCPPGLGLLTLNALVAASSVLIPLQCEFFALEGISQLMRTIDLVRHSLNPGLAL 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTM D RN+L+Q V  DVR   GG+V++TVIPRN+RI+E+PS+GKP ++YD +  G
Sbjct: 182 EGVVLTMLDRRNNLAQAVSDDVRAYFGGRVFDTVIPRNIRITESPSHGKPVLLYDFRSVG 241

Query: 244 SQAYLKLASELIQQER 259
           +QAY+ LA+E +Q+++
Sbjct: 242 AQAYVALAAEFLQRQK 257


>gi|58617652|ref|YP_196851.1| sporulation initiation inhibitor protein soj [Ehrlichia ruminantium
           str. Gardel]
 gi|58417264|emb|CAI28377.1| Sporulation initiation inhibitor protein soj [Ehrlichia ruminantium
           str. Gardel]
          Length = 260

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 140/255 (54%), Positives = 194/255 (76%), Gaps = 1/255 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++  I NQKGGVGKTTT+INL+TA A + +  LLIDLDPQGN+STG GI    R  + Y
Sbjct: 7   SKVFGIVNQKGGVGKTTTSINLATAFAIVNKKTLLIDLDPQGNSSTGFGITYQQRTNTVY 66

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI     +  +I+T IPNL ++PST+DL   E+ L   + R F L  +L +++ + + 
Sbjct: 67  EVLINNIPTSSAIIKTEIPNLDLLPSTVDLSAAEVELTQVQKREFVLKNSL-LEIKTSYD 125

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AA+++++PLQCEFFALEGLS L++T+E +++ +N +L I+G
Sbjct: 126 YIFIDCPPSLGLLTVNALIAANAVIIPLQCEFFALEGLSHLIKTIELIKKHLNPSLSIEG 185

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           IILTM+D RN LS+QV  D+RK L   VY TVIPRNVR+SEAPS+GKPAIIYD KCAGSQ
Sbjct: 186 IILTMYDKRNKLSEQVEEDIRKYLKESVYKTVIPRNVRLSEAPSHGKPAIIYDFKCAGSQ 245

Query: 246 AYLKLASELIQQERH 260
           AY+ LA E+++++++
Sbjct: 246 AYIYLAKEILKRQQN 260


>gi|94496560|ref|ZP_01303136.1| chromosome partitioning protein ATPase component [Sphingomonas sp.
           SKA58]
 gi|94423920|gb|EAT08945.1| chromosome partitioning protein ATPase component [Sphingomonas sp.
           SKA58]
          Length = 260

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 184/249 (73%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAINL+T LAA G  VLL+DLDPQGNASTGLG++   R+ SSYDLL
Sbjct: 4   IAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNASTGLGVDQAARERSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           +    ++  ++ T +P L ++P+T DL G E+ L   ++R  RL++ LS      +    
Sbjct: 64  VGNCALDDSIVTTRVPKLDLVPATQDLSGAEIELIEYEERTHRLERVLSEAQPGRWDICL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NAM AA S+LVPLQCEFFALEGLSQLL+TVE +R   N  L I G+ L
Sbjct: 124 IDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQTVERIRGRFNPGLSIMGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L+ QV  DVR  LG  V++TVIPRNVR+SEAPS+G PA+IYD +C+GS+AY+
Sbjct: 184 TMYDRRNRLTDQVADDVRACLGDLVFSTVIPRNVRLSEAPSHGVPALIYDFRCSGSEAYM 243

Query: 249 KLASELIQQ 257
           +LA ELI +
Sbjct: 244 RLARELIAR 252


>gi|114326673|ref|YP_743830.1| chromosome partitioning protein parA [Granulibacter bethesdensis
           CGDNIH1]
 gi|114314847|gb|ABI60907.1| chromosome partitioning protein parA [Granulibacter bethesdensis
           CGDNIH1]
          Length = 304

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 193/261 (73%), Gaps = 6/261 (2%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + +I+ IANQKGGVGKTTTAINL+TALA  GE VLLIDLD QGNASTGLGI    R + S
Sbjct: 37  RPKILAIANQKGGVGKTTTAINLATALAETGERVLLIDLDSQGNASTGLGIPRNQRGHGS 96

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD- 123
           Y +L+       ++  + +PNL +I + +DL G E+ L  +  R +RL +AL     +D 
Sbjct: 97  YAVLMGSHKAADVIRTSIVPNLFLIVAEIDLAGTEVELVAQNRREYRLREALDALKNADQ 156

Query: 124 -----FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
                F ++ +DCPPS  LLT+NA+ AADS+LVPLQCEFFALEG++QL  TV+ VRR +N
Sbjct: 157 TPELSFDHVLIDCPPSLGLLTLNALVAADSVLVPLQCEFFALEGVTQLNRTVQAVRRALN 216

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
            AL+++GI+LTMFD RN+LS+ V +D R   G KVY+TVIPRN+R+SEAPS+GKP ++YD
Sbjct: 217 PALELEGIVLTMFDRRNNLSELVAADARGFFGAKVYDTVIPRNIRLSEAPSHGKPVLLYD 276

Query: 239 LKCAGSQAYLKLASELIQQER 259
            K +G+QAY++LA EL+++ER
Sbjct: 277 SKSSGAQAYVQLADELLKRER 297


>gi|110677824|ref|YP_680831.1| chromosome partitioning protein ParA [Roseobacter denitrificans OCh
           114]
 gi|109453940|gb|ABG30145.1| chromosome partitioning protein ParA [Roseobacter denitrificans OCh
           114]
          Length = 269

 Score =  297 bits (761), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 148/256 (57%), Positives = 188/256 (73%), Gaps = 4/256 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT INL+ ALA  G  VL++DLDPQGNASTGLGIE+ DRKY++YD
Sbjct: 11  KIIAVANQKGGVGKTTTTINLAAALAEAGRRVLVVDLDPQGNASTGLGIEVEDRKYTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           +L+ + +I  +++QT  PNL I+P+T+DL   ++ L   + R F L  AL  Q+  D   
Sbjct: 71  ILLGDVDIKDVVLQTVTPNLLIVPATVDLSSADLELMSSEKRSFLLHDALR-QIEMDGFN 129

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             Y+ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L I
Sbjct: 130 LDYVLIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTGNKDLRI 189

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +GI+LTM+D RN+LS QV  D R NLG  V++T IPRNVR+SEAPS+  P + YD    G
Sbjct: 190 EGILLTMYDKRNNLSLQVEQDARDNLGDMVFSTRIPRNVRVSEAPSFAMPVLTYDTMSKG 249

Query: 244 SQAYLKLASELIQQER 259
           +QAY  LA ELIQ+ R
Sbjct: 250 AQAYRALAKELIQKHR 265


>gi|148261390|ref|YP_001235517.1| cobyrinic acid a,c-diamide synthase [Acidiphilium cryptum JF-5]
 gi|146403071|gb|ABQ31598.1| chromosome segregation ATPase [Acidiphilium cryptum JF-5]
          Length = 263

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 137/256 (53%), Positives = 188/256 (73%), Gaps = 1/256 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + +II IANQKGGVGKTTTAINL+TALAA GE VLLIDLDPQGNASTG GI   +R   S
Sbjct: 2   QPKIIAIANQKGGVGKTTTAINLATALAATGERVLLIDLDPQGNASTGFGIGTDERGIGS 61

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTSD 123
           Y L+  E     +++ T +P L IIP+T DL+G ++   G + R   + +AL    L   
Sbjct: 62  YALMTGEAPAASLVLPTEVPGLLIIPATEDLIGADIEFAGAEGREHLVQRALDEPGLAGQ 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F Y+F+DCPP   LLT+NA+ AA S+L+PLQCEFFALEG+SQL+ T++ VR ++N  L +
Sbjct: 122 FGYVFIDCPPGLGLLTLNALVAASSVLIPLQCEFFALEGISQLMRTIDLVRHSLNPGLAL 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTM D RN+L+Q V  DVR   GG+V++T IPRN+RI+E+PS+GKP ++YD +  G
Sbjct: 182 EGVVLTMLDRRNNLAQAVSDDVRAYFGGRVFDTAIPRNIRITESPSHGKPVLLYDFRSVG 241

Query: 244 SQAYLKLASELIQQER 259
           +QAY+ LA+E +Q+++
Sbjct: 242 AQAYVALAAEFLQRQK 257


>gi|241762353|ref|ZP_04760433.1| Cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373147|gb|EER62786.1| Cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 266

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 183/254 (72%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTT+AINLSTALAAIG  VL+ID DPQGNASTGLGI+   R+ S+Y +L
Sbjct: 4   IAIANQKGGVGKTTSAINLSTALAAIGWRVLVIDFDPQGNASTGLGIKHEHRRVSAYQVL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
             E  + + +++TA+P L IIP+T+DL G E+ L    +R  RL   L       +    
Sbjct: 64  TGEAALTEGVVKTAVPGLEIIPATVDLSGAEIDLLSIGERTHRLAHVLDTAPPDRWDACL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AA  ++VPLQCEFFALEGLSQLL T+E VR   N +L I G+ L
Sbjct: 124 IDCPPSLGLLTVNALVAAHKLMVPLQCEFFALEGLSQLLTTIERVRSRFNPSLSILGVTL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN LS QV  DVR+ LG  V+NT IPRNVR+SEAPS+G PA+IYD +CAGS+AY+
Sbjct: 184 TMYDRRNRLSDQVADDVREVLGRVVFNTTIPRNVRLSEAPSHGIPALIYDHRCAGSEAYM 243

Query: 249 KLASELIQQERHRK 262
            LA E+I +   +K
Sbjct: 244 ALAREVIDRLSSKK 257


>gi|56552875|ref|YP_163714.1| cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|260753425|ref|YP_003226318.1| cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56544449|gb|AAV90603.1| Cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|258552788|gb|ACV75734.1| Cobyrinic acid ac-diamide synthase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 266

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 183/254 (72%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTT+AINLSTALAAIG  VL+ID DPQGNASTGLGI+   R+ S+Y +L
Sbjct: 4   IAIANQKGGVGKTTSAINLSTALAAIGWRVLVIDFDPQGNASTGLGIKHEHRRVSAYQVL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
             E  + + +++TA+P L IIP+T+DL G E+ L    +R  RL   L       +    
Sbjct: 64  TGEAALTEGVVKTAVPGLEIIPATVDLSGAEIDLLSIGERTHRLAHVLDTAPPDRWDACL 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AA  ++VPLQCEFFALEGLSQLL T+E VR   N +L I G+ L
Sbjct: 124 IDCPPSLGLLTVNALVAAHKLMVPLQCEFFALEGLSQLLTTIERVRSRFNPSLSILGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN LS QV  DVR+ LG  V+NT IPRNVR+SEAPS+G PA+IYD +CAGS+AY+
Sbjct: 184 TMYDRRNRLSDQVADDVREVLGRVVFNTTIPRNVRLSEAPSHGIPALIYDHRCAGSEAYM 243

Query: 249 KLASELIQQERHRK 262
            LA E+I +   +K
Sbjct: 244 ALAREVIDRLSSKK 257


>gi|296284828|ref|ZP_06862826.1| chromosome partitioning protein ATPase component [Citromicrobium
           bathyomarinum JL354]
          Length = 259

 Score =  295 bits (755), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 160/259 (61%), Positives = 200/259 (77%), Gaps = 5/259 (1%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAIN++TA+AA G   LLIDLDPQGNASTGLGI   DR+ S+YDLL
Sbjct: 4   IAIANQKGGVGKTTTAINIATAIAATGWRTLLIDLDPQGNASTGLGIPSRDREDSTYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY-- 126
           +EE  + Q  ++T IPNL IIP+T DL G E+ L  E DR+ RL KAL+    +D  Y  
Sbjct: 64  MEEATVAQCTLKTRIPNLDIIPATQDLSGAEVELVAEGDRVERLKKALA---NADHHYDV 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
            F+DCPPS  LLT+NA++AADS++VPLQCEFFALEGLSQLL+TVE V++ +N +L+I G+
Sbjct: 121 CFIDCPPSLGLLTLNALSAADSLMVPLQCEFFALEGLSQLLQTVERVQQGINPSLNIIGV 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
            LTMFD RN L+  V  DVR+ LGG V++TVIPRNVR+SEAPS+G PA+IYD  CAGS+A
Sbjct: 181 TLTMFDRRNRLTDAVAEDVRECLGGLVFDTVIPRNVRLSEAPSHGLPALIYDHSCAGSRA 240

Query: 247 YLKLASELIQQERHRKEAA 265
           Y+ LA EL+ +    ++AA
Sbjct: 241 YMALARELLGRMPLERKAA 259


>gi|326386154|ref|ZP_08207778.1| chromosome segregation ATPase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209379|gb|EGD60172.1| chromosome segregation ATPase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 258

 Score =  295 bits (754), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 149/257 (57%), Positives = 188/257 (73%), Gaps = 2/257 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAIN++TALAA G  VLL DLDPQGNASTGLG+   +R+ SSYDLL
Sbjct: 4   IAIANQKGGVGKTTTAINVATALAATGWKVLLADLDPQGNASTGLGVSAAERERSSYDLL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           I+  ++    + T IP L ++P+T+DL G E+ L   ++R  RL  ALS     D   + 
Sbjct: 64  IDGASVADCSMATRIPGLDLLPATVDLSGAEVELVSVENRTGRLRAALSEDTVHDICLV- 122

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
            DCPPS  LLT+NA+ AAD++LVPLQCEFFALEGLSQLL+TVE V+   N  L I G++L
Sbjct: 123 -DCPPSLGLLTLNALTAADTLLVPLQCEFFALEGLSQLLQTVERVQERFNPDLGILGVVL 181

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN L++QV  DVR  L   V+  VIPRNVR+SEAPS+G PA+IYD  CAGSQAY+
Sbjct: 182 TMYDRRNRLTEQVSDDVRSCLNELVFEAVIPRNVRLSEAPSHGVPALIYDHSCAGSQAYM 241

Query: 249 KLASELIQQERHRKEAA 265
           KLA E++ +   +++AA
Sbjct: 242 KLAREILTRLPEQRKAA 258


>gi|126730101|ref|ZP_01745913.1| chromosome partitioning protein ParA [Sagittula stellata E-37]
 gi|126709481|gb|EBA08535.1| chromosome partitioning protein ParA [Sagittula stellata E-37]
          Length = 280

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 193/257 (75%), Gaps = 3/257 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT INL  AL  +G+ VL++DLDPQGNASTGLGIE  DR+Y++Y+
Sbjct: 22  RIIAVANQKGGVGKTTTTINLGAALCELGQKVLVVDLDPQGNASTGLGIEPEDREYTTYE 81

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--DF 124
           LL++E +++ +++ T+  NL +IP+T+DL   ++ L   + R + L  AL     S  DF
Sbjct: 82  LLLDEADLDSVILSTSTDNLHLIPATVDLSSADIELISNEKRSYLLHDALRQPAMSRLDF 141

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
             + +DCPPS NLLT+NAM A+ S+LVPLQ EFFALEGLSQL+ T+ EVR++ N  L I+
Sbjct: 142 DVVLIDCPPSLNLLTVNAMVASHSVLVPLQSEFFALEGLSQLMLTIREVRQSANPGLRIE 201

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D+RN+LSQ V +D R NLG  V++TVIPRNVR+SEAPSY  P + YD    G+
Sbjct: 202 GIVLTMYDARNNLSQLVEADARSNLGDLVFSTVIPRNVRVSEAPSYALPVLAYDTGSKGA 261

Query: 245 QAYLKLASELIQQ-ERH 260
           QAY  LA+ELI++ E+H
Sbjct: 262 QAYRALAAELIKKYEKH 278


>gi|56417249|ref|YP_154323.1| chromosome partitioning protein [Anaplasma marginale str. St.
           Maries]
 gi|222475613|ref|YP_002564030.1| chromosome partitioning protein (parA) [Anaplasma marginale str.
           Florida]
 gi|56388481|gb|AAV87068.1| chromosome partitioning protein [Anaplasma marginale str. St.
           Maries]
 gi|222419751|gb|ACM49774.1| chromosome partitioning protein (parA) [Anaplasma marginale str.
           Florida]
          Length = 271

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 191/253 (75%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++  + NQKGGVGKTTT+INL+TA A +G++ L++DLDPQGN+S+GLGI    R    Y
Sbjct: 4   AKVFAVVNQKGGVGKTTTSINLATAFAVVGKSTLMVDLDPQGNSSSGLGIPYSSRSPDIY 63

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L++   I + +  T IPNLSI+PST+DL   E+ L   + R F L   L    T+++ 
Sbjct: 64  RVLVDNHPITEAIRSTCIPNLSIVPSTIDLSAAELGLAQMESREFVLKNCL--LHTAEYQ 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS  LLT+NA+AAA S+++P+QCEFFALEGL  L++TV  V++ +N +L I+G
Sbjct: 122 YVFVDCPPSLGLLTINALAAAHSVIIPMQCEFFALEGLKHLMKTVNLVKKRLNPSLTIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D RN+LS+QV  ++R++L   VY TVIPRNVR+SEAPS+GKPAIIYD KC GSQ
Sbjct: 182 ILLTMYDRRNNLSEQVEENIREHLRENVYKTVIPRNVRLSEAPSHGKPAIIYDYKCPGSQ 241

Query: 246 AYLKLASELIQQE 258
           +Y+ LA E+++Q+
Sbjct: 242 SYIYLAKEILEQQ 254


>gi|148555757|ref|YP_001263339.1| chromosome segregation ATPase [Sphingomonas wittichii RW1]
 gi|148500947|gb|ABQ69201.1| chromosome segregation ATPase [Sphingomonas wittichii RW1]
          Length = 259

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/257 (56%), Positives = 188/257 (73%), Gaps = 1/257 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTAINL+TALAA G  VLL+D DPQGNASTGLG++   R+ SSY+LL
Sbjct: 4   IAIANQKGGVGKTTTAINLATALAATGWRVLLVDFDPQGNASTGLGVDQASRERSSYELL 63

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
             +  + + ++ T IP L I+P+T+DL G E+ L   + R  RL  AL+ Q  + +    
Sbjct: 64  RRDCTLGEAVVATKIPRLDIVPATVDLTGAEIELIDVEKRTHRLHDALA-QDENRWDVCL 122

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AA+ +LVPLQCEFFALEGL+QLL+T+E VR   N  L I G+ L
Sbjct: 123 IDCPPSLGLLTVNALVAANMMLVPLQCEFFALEGLTQLLQTIERVRARFNPQLSILGVAL 182

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN LS+QV +DVR  LG  V+ TVIPRNVR+SEAPS+G PA+IYD +C GS+AY+
Sbjct: 183 TMYDRRNRLSEQVAADVRDVLGNVVFETVIPRNVRLSEAPSHGVPALIYDHRCPGSEAYI 242

Query: 249 KLASELIQQERHRKEAA 265
            LA E I +  ++ +AA
Sbjct: 243 ALARECIARLTNKAQAA 259


>gi|254995419|ref|ZP_05277609.1| chromosome partitioning protein (parA) [Anaplasma marginale str.
           Mississippi]
 gi|255003606|ref|ZP_05278570.1| chromosome partitioning protein (parA) [Anaplasma marginale str.
           Puerto Rico]
 gi|255004735|ref|ZP_05279536.1| chromosome partitioning protein (parA) [Anaplasma marginale str.
           Virginia]
 gi|269958361|ref|YP_003328148.1| sporulation initiation inhibitor protein [Anaplasma centrale str.
           Israel]
 gi|269848190|gb|ACZ48834.1| sporulation initiation inhibitor protein [Anaplasma centrale str.
           Israel]
          Length = 269

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 191/253 (75%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++  + NQKGGVGKTTT+INL+TA A +G++ L++DLDPQGN+S+GLGI    R    Y
Sbjct: 2   AKVFAVVNQKGGVGKTTTSINLATAFAVVGKSTLMVDLDPQGNSSSGLGIPYSSRSPDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L++   I + +  T IPNLSI+PST+DL   E+ L   + R F L   L    T+++ 
Sbjct: 62  RVLVDNHPITEAIRSTCIPNLSIVPSTIDLSAAELGLAQMESREFVLKNCL--LHTAEYQ 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS  LLT+NA+AAA S+++P+QCEFFALEGL  L++TV  V++ +N +L I+G
Sbjct: 120 YVFVDCPPSLGLLTINALAAAHSVIIPMQCEFFALEGLKHLMKTVNLVKKRLNPSLTIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D RN+LS+QV  ++R++L   VY TVIPRNVR+SEAPS+GKPAIIYD KC GSQ
Sbjct: 180 ILLTMYDRRNNLSEQVEENIREHLRENVYKTVIPRNVRLSEAPSHGKPAIIYDYKCPGSQ 239

Query: 246 AYLKLASELIQQE 258
           +Y+ LA E+++Q+
Sbjct: 240 SYIYLAKEILEQQ 252


>gi|149912892|ref|ZP_01901426.1| chromosome partitioning protein ParA [Roseobacter sp. AzwK-3b]
 gi|149813298|gb|EDM73124.1| chromosome partitioning protein ParA [Roseobacter sp. AzwK-3b]
          Length = 269

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 187/257 (72%), Gaps = 2/257 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  +II +ANQKGGVGKTTT INL  ALA  G+ VL+IDLDPQGNASTGLGI+  DR+ +
Sbjct: 8   RGPKIIAVANQKGGVGKTTTTINLGAALAEAGQKVLIIDLDPQGNASTGLGIDASDRELT 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           +Y+LL+EE ++++++ +TA  NL I+P+T+DL   +M L   + R F L  AL      D
Sbjct: 68  TYELLLEEIDLSEVVQETAFDNLLIVPATVDLSSADMELIATEKRSFLLHDALRQTAMDD 127

Query: 124 FS--YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           ++  YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L
Sbjct: 128 YAIDYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTANPNL 187

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++LTMFD+RN+LS QV  D R NLG  V+ T IPRNVR+SEAPSY  P + YD   
Sbjct: 188 RIEGVVLTMFDARNNLSSQVEQDARDNLGALVFQTRIPRNVRVSEAPSYAVPVLQYDSAS 247

Query: 242 AGSQAYLKLASELIQQE 258
            G+QAY  LA EL+  +
Sbjct: 248 KGAQAYRDLARELMSNQ 264


>gi|159045997|ref|YP_001534791.1| chromosome partitioning protein ParA [Dinoroseobacter shibae DFL
           12]
 gi|157913757|gb|ABV95190.1| chromosome partitioning protein ParA [Dinoroseobacter shibae DFL
           12]
          Length = 268

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 183/258 (70%), Gaps = 4/258 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K+R+I IANQKGGVGKTTT INL TAL   G+ VL+IDLDPQGNASTGLG+    R  ++
Sbjct: 9   KARVIAIANQKGGVGKTTTTINLGTALTMRGKTVLIIDLDPQGNASTGLGMAPETRSLTT 68

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV--QLTS 122
           YDLL+E   I  +  +T++ NL + P+T DL   ++ L     R+FRL  AL+    L  
Sbjct: 69  YDLLVENAAIADVSRETSVENLFLAPATTDLSSADIELMSNSRRVFRLRAALTQLNALPK 128

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
              Y+ +DCPPS NLLT+NAM AADS+LVPLQ EFFALEGLSQLL +V EVR T N  L 
Sbjct: 129 RVDYVLVDCPPSLNLLTVNAMVAADSVLVPLQSEFFALEGLSQLLLSVREVRETANPKLR 188

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+LTM+D RN+LS+QV  D R NLG  V+ T+IPRNVR+SEAPS+  P + YD    
Sbjct: 189 IEGIVLTMYDRRNNLSRQVEEDARANLGELVFKTIIPRNVRVSEAPSFAMPVLRYDPSSQ 248

Query: 243 GSQAYLKLASELIQQERH 260
           GSQAYL LA E++  ERH
Sbjct: 249 GSQAYLGLADEIL--ERH 264


>gi|259417242|ref|ZP_05741161.1| chromosome partitioning protein ParA [Silicibacter sp. TrichCH4B]
 gi|259346148|gb|EEW57962.1| chromosome partitioning protein ParA [Silicibacter sp. TrichCH4B]
          Length = 267

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 143/251 (56%), Positives = 183/251 (72%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINL+ AL   G  VLL+DLDPQGNASTGLGIE  DR +++YD
Sbjct: 8   RIIAIANQKGGVGKTTTAINLAAALVEEGMRVLLVDLDPQGNASTGLGIEADDRDHTTYD 67

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--DF 124
           LL+EE  +++++ QT + +L I+P+T+DL   ++ L   + R F L  AL     +  D+
Sbjct: 68  LLVEEAELSEVIRQTDLEDLCIVPATVDLSSADIELFSNEKRSFLLHDALRQPAMAEYDW 127

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+L+PLQ EFFALEGLSQL+ T+ EVR   N  L I+
Sbjct: 128 DYILIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGLSQLMLTIREVRHAANPQLRIE 187

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D RN+LSQQV  D R NLG  V+ T IPRNVR+SEAPSY  P + YD    G+
Sbjct: 188 GVVLTMYDRRNNLSQQVEQDARDNLGDLVFRTKIPRNVRVSEAPSYAMPVLNYDPASLGA 247

Query: 245 QAYLKLASELI 255
           +AY +LA E++
Sbjct: 248 KAYRQLAGEIV 258


>gi|254466950|ref|ZP_05080361.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           Y4I]
 gi|206687858|gb|EDZ48340.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           Y4I]
          Length = 269

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/261 (55%), Positives = 188/261 (72%), Gaps = 4/261 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+ AL   G  VL++DLDPQGNASTGLGIE  DR+ ++YD
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAALVECGLRVLVVDLDPQGNASTGLGIEPADRELTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+E+ ++  ++ QT I +L IIP+T+DL   ++ L   + R F L  AL  +     D+
Sbjct: 71  LLVEDASLTDVIRQTEIEDLCIIPATVDLSSADIELFTNEKRSFLLHDALRQTAMDDYDW 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS NLLT+NAM AA S+L+PLQ EFFALEG++QL+ T+ EVR++ N  L I+
Sbjct: 131 DYVLIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGVTQLMLTIREVRQSANPNLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN+LSQQV  D R NLG  V+ T IPRNVR+SEAPSY  P + YD    G+
Sbjct: 191 GIVLTMFDRRNNLSQQVEQDARDNLGDLVFQTKIPRNVRVSEAPSYALPVLNYDTNSLGA 250

Query: 245 QAYLKLASELIQQERHRKEAA 265
           QAY  LA E++   +H K AA
Sbjct: 251 QAYRALAEEILN--KHHKIAA 269


>gi|302342508|ref|YP_003807037.1| Cobyrinic acid ac-diamide synthase [Desulfarculus baarsii DSM 2075]
 gi|301639121|gb|ADK84443.1| Cobyrinic acid ac-diamide synthase [Desulfarculus baarsii DSM 2075]
          Length = 260

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 190/260 (73%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            R+I IANQKGGVGKTTTA+NL+ +LAA   +VLL+D DPQGNAS+GLG+++     + Y
Sbjct: 2   GRVICIANQKGGVGKTTTAVNLAASLAAAERDVLLVDCDPQGNASSGLGVKIGPGDNTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI+       L  T + +L++I S ++L G+E+ LGG +     L  +L  ++ S F 
Sbjct: 62  QMLIDHCRAADALRATELEHLTLIGSNVNLFGVEVELGGTEGSERLLANSLG-EIVSRFE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIFLDCPPS  LLT+NA+ A D +L+PLQCE++ALEGL+QLL+TV  VRR  N+ L ++G
Sbjct: 121 YIFLDCPPSLGLLTLNALTACDGVLIPLQCEYYALEGLTQLLQTVARVRRNFNAGLGLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D RN+L++QV  DVR + G  VY TVIPRNVR+SEAPS+GKP ++YD+K +G+Q
Sbjct: 181 IVLTMYDGRNNLARQVEGDVRGHFGEMVYETVIPRNVRLSEAPSHGKPVLLYDIKSSGAQ 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E++   R R EA+
Sbjct: 241 AYLSLAREMMAGPRRRGEAS 260


>gi|99082707|ref|YP_614861.1| chromosome segregation ATPase [Ruegeria sp. TM1040]
 gi|99038987|gb|ABF65599.1| chromosome segregation ATPase [Ruegeria sp. TM1040]
          Length = 270

 Score =  288 bits (736), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINL+ AL   G  VLL+DLDPQGNASTGLG+E+ DR++++YD
Sbjct: 11  RIIAIANQKGGVGKTTTAINLAAALVEEGMRVLLVDLDPQGNASTGLGVEVDDREHTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--DF 124
           LL+EE  ++Q++ +T + +L I+P+ +DL   ++ L   + R F L  AL     +  D+
Sbjct: 71  LLVEEAELSQVIRETDLEDLCIVPANVDLSSADIELFSNEKRSFLLHDALRQPAMTEYDW 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+L+PLQ EFFALEGLSQL+ T+ EVR+  N  L I+
Sbjct: 131 DYILIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGLSQLMLTIREVRQAANPQLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D RN+LSQQV  D R NLG  V+ T IPRNVR+SE+PSY  P + YD    G+
Sbjct: 191 GVVLTMYDRRNNLSQQVEQDARDNLGDLVFRTKIPRNVRVSESPSYAMPVLNYDPSSLGA 250

Query: 245 QAYLKLASELI 255
           +AY +LA E+I
Sbjct: 251 KAYRQLAGEII 261


>gi|206891124|ref|YP_002249779.1| sporulation initiation inhibitor protein soj [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206743062|gb|ACI22119.1| sporulation initiation inhibitor protein soj [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 256

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 186/255 (72%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +IITIANQKGGVGKTTTA+NL   L+  G+ VLL+D DPQGN +TG+GI   +   S YD
Sbjct: 3   KIITIANQKGGVGKTTTALNLGACLSIEGKKVLLVDSDPQGNLTTGVGILRDELSLSLYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L +   ++    +QTA  NL IIPST+DL+G+E+ L   ++R F L K LS Q  SDF +
Sbjct: 63  LYMNSSSLETAKVQTAYENLWIIPSTIDLVGVEVELVHRENREFVLKKMLS-QFGSDFDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +D PPS  LLT+N +  ADS+++P+QCE++ALEGL  L++TVE VR  +N AL I+GI
Sbjct: 122 IIIDAPPSLGLLTLNCLVCADSLIIPVQCEYYALEGLGLLMKTVELVRAKLNPALKIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN+LS+QV  +VRK  G KVYNTVIPRNV ++EAPS+GKPA+ YD++  GSQ+
Sbjct: 182 LLTMFDGRNTLSKQVAEEVRKFFGKKVYNTVIPRNVTLAEAPSHGKPAVFYDMRSKGSQS 241

Query: 247 YLKLASELIQQERHR 261
           YL  A E + +E  R
Sbjct: 242 YLSFAMEFLSEESTR 256


>gi|294675618|ref|YP_003576233.1| chromosome-partitioning protein ParA [Rhodobacter capsulatus SB
           1003]
 gi|294474438|gb|ADE83826.1| chromosome-partitioning protein ParA [Rhodobacter capsulatus SB
           1003]
          Length = 273

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 151/265 (56%), Positives = 187/265 (70%), Gaps = 8/265 (3%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RII IANQKGGVGKTTTAINL+ A+A  G  VLL+DLDPQGNASTGLGIE  DRK+S+
Sbjct: 9   QPRIIAIANQKGGVGKTTTAINLAAAMAERGCRVLLVDLDPQGNASTGLGIEAADRKFST 68

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           YDLL  E  +++++ +TA   L I P+T DL   +M L   + R F L  AL  Q   D 
Sbjct: 69  YDLLFGEAPLSEVVQKTAFDGLLISPATTDLSSADMELVSSEKRTFLLHDALR-QTDIDL 127

Query: 125 ---SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
               Y+ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L
Sbjct: 128 LRLDYVLIDCPPSLNLLTVNAMVAAQSVLVPLQAEFFALEGLSQLMLTIREVRQTANRDL 187

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++LTM+D RN+LSQQV +D R  LG  V+ T+IPRNVRISEAPSY  P + YD   
Sbjct: 188 RIEGVVLTMYDVRNNLSQQVEADARGTLGELVFRTMIPRNVRISEAPSYALPVLSYDAGS 247

Query: 242 AGSQAYLKLASELIQ----QERHRK 262
            G++AY  LA+EL+     QER  +
Sbjct: 248 KGAEAYRSLAAELLDLHATQERKAR 272


>gi|119382763|ref|YP_913819.1| cobyrinic acid a,c-diamide synthase [Paracoccus denitrificans
           PD1222]
 gi|119372530|gb|ABL68123.1| Cobyrinic acid a,c-diamide synthase [Paracoccus denitrificans
           PD1222]
          Length = 258

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 144/253 (56%), Positives = 179/253 (70%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII +ANQKGGVGKTTTAINL  ALA  G+ V +IDLDPQGNASTGLG+ L +R+ +SY
Sbjct: 4   TRIIAVANQKGGVGKTTTAINLGAALAEQGQRVAIIDLDPQGNASTGLGVPLEERELTSY 63

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL  E+ + + L  TAI NL ++PS  DL   +  L     R   L + LS    S+F 
Sbjct: 64  DLLTGERALQETLRDTAIANLRVVPSNRDLASADFELSNRPGRTQLLRRKLSA--PSEFD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+  LLT+NAM A+DS+LVPLQ EF+ALEGLSQLL TV EVR+T N  L I+G
Sbjct: 122 YILIDCPPALGLLTVNAMVASDSVLVPLQAEFYALEGLSQLLMTVREVRQTANPDLRIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+RN+LSQQV +D R  L G VY TVIPRNVR+SEAPS+  P + YD    GS 
Sbjct: 182 VLLTMSDNRNNLSQQVEADARSTLSGLVYRTVIPRNVRLSEAPSHAMPVLQYDPNSKGSH 241

Query: 246 AYLKLASELIQQE 258
           AY  LA E + ++
Sbjct: 242 AYRDLAREFLSRQ 254


>gi|85706896|ref|ZP_01037986.1| chromosome partitioning protein ParA [Roseovarius sp. 217]
 gi|85668507|gb|EAQ23378.1| chromosome partitioning protein ParA [Roseovarius sp. 217]
          Length = 269

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 182/252 (72%), Gaps = 2/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT INL  ALA  G  VL++DLDPQGNASTGLGIE   R +++YD
Sbjct: 11  KIIAVANQKGGVGKTTTTINLGAALAETGARVLIVDLDPQGNASTGLGIEAEARTFTAYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL++E +++ ++  T + +LSIIP+T+DL   ++ L   + R F L  AL        +F
Sbjct: 71  LLLDEISLDDVIQPTGVDHLSIIPATVDLSSADIELISNEKRSFLLHDALRQPAMDAYEF 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA SILVPLQ EFFALEGLSQL+ T+ E+R+T N AL I+
Sbjct: 131 EYILIDCPPSLNLLTVNAMVAAHSILVPLQSEFFALEGLSQLMLTIREIRQTANPALRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFD+RN+LS QV  D R NLG  V+ T IPRNVR+SEAPSY    + YD    G+
Sbjct: 191 GVVLTMFDARNNLSTQVEQDARDNLGDLVFKTRIPRNVRVSEAPSYAMSVLSYDPLSKGA 250

Query: 245 QAYLKLASELIQ 256
           QAY  LA EL+Q
Sbjct: 251 QAYRDLAQELMQ 262


>gi|254489038|ref|ZP_05102243.1| chromosome partitioning protein ParA [Roseobacter sp. GAI101]
 gi|214045907|gb|EEB86545.1| chromosome partitioning protein ParA [Roseobacter sp. GAI101]
          Length = 266

 Score =  285 bits (729), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 185/252 (73%), Gaps = 4/252 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT INL+ AL  +   VL++DLDPQGNASTGLGIEL DR++++Y+
Sbjct: 11  KIIAVANQKGGVGKTTTTINLAAALVEMDHRVLVVDLDPQGNASTGLGIELEDREFTTYE 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           LL+E+  ++Q+++ T    L I+P+T+DL   ++ L   + R F L  AL  Q   D   
Sbjct: 71  LLLEDVALDQVILTTQTEGLHIVPATVDLSSADLELISNEKRSFLLHDALR-QTQMDGYA 129

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR++ N  L I
Sbjct: 130 FDYILIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRI 189

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +GI+LTM+D RN+LSQQV  D R NLG  VY TVIPRNVR+SEAPS+  P + YD    G
Sbjct: 190 EGIVLTMYDQRNNLSQQVEQDARSNLGELVYKTVIPRNVRVSEAPSFAMPVLSYDTGSKG 249

Query: 244 SQAYLKLASELI 255
           ++AY +LA E++
Sbjct: 250 AKAYRELAKEIL 261


>gi|296533441|ref|ZP_06896024.1| sporulation initiation inhibitor protein Soj [Roseomonas cervicalis
           ATCC 49957]
 gi|296266221|gb|EFH12263.1| sporulation initiation inhibitor protein Soj [Roseomonas cervicalis
           ATCC 49957]
          Length = 269

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 193/261 (73%), Gaps = 3/261 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I +ANQKGGVGKTTTAINL+TALA   + VL+IDLDPQGNASTGLG+   +R   +Y 
Sbjct: 9   RRIALANQKGGVGKTTTAINLATALAT-KKRVLVIDLDPQGNASTGLGLPRAERGAGTYA 67

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+ +K ++++L  T +P+L ++P+  DL G E+ L G ++R  RL  AL  +     DF
Sbjct: 68  LLVGQKPLSELLRPTKVPDLMLLPADNDLAGAEIELVGMENREHRLRLALEAAADTLKDF 127

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            +I +DCPPS  LLT+NA+ A +S+L+PLQ EFFALEG+SQ+  T++ VRR +N AL + 
Sbjct: 128 DFILIDCPPSLGLLTLNALVAVESVLIPLQTEFFALEGVSQITRTIDRVRRVLNPALALD 187

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN+LS+ V +DVR     KV++TV+PRN+R+SEAPS+G P ++YD +  G+
Sbjct: 188 GIVLTMFDRRNNLSELVAADVRAFFRDKVFDTVVPRNIRVSEAPSHGLPVLLYDPRSTGA 247

Query: 245 QAYLKLASELIQQERHRKEAA 265
           QAY+KLA+EL+++ER R   A
Sbjct: 248 QAYIKLAAELLRRERARGSKA 268


>gi|83942030|ref|ZP_00954492.1| chromosome partitioning protein ParA [Sulfitobacter sp. EE-36]
 gi|83847850|gb|EAP85725.1| chromosome partitioning protein ParA [Sulfitobacter sp. EE-36]
          Length = 266

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 145/251 (57%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL+ AL    + VL+IDLDPQGNASTGLGIEL DR++++Y+
Sbjct: 11  KIIAIANQKGGVGKTTTTINLAAALVEQKQRVLVIDLDPQGNASTGLGIELDDREFTTYE 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTS-DF 124
           LL+E+ +++Q+++ T    L I+ +T+DL   +M L   + R F L  AL   Q+ S  F
Sbjct: 71  LLLEDIDLDQVIMTTETEGLHIVAATVDLSSADMELIANEKRSFLLHDALRQTQMDSYAF 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR++ N  L I+
Sbjct: 131 DYILIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D RN+LSQQV  D R NLG  VY TVIPRNVR+SEAPSY  P + YD    G+
Sbjct: 191 GILLTMYDQRNNLSQQVEQDARSNLGELVYRTVIPRNVRVSEAPSYAMPVLSYDSGSKGA 250

Query: 245 QAYLKLASELI 255
           +AY  LA E++
Sbjct: 251 KAYRDLAKEVL 261


>gi|254477053|ref|ZP_05090439.1| cobyrinic Acid a,c-diamide synthase [Ruegeria sp. R11]
 gi|214031296|gb|EEB72131.1| cobyrinic Acid a,c-diamide synthase [Ruegeria sp. R11]
          Length = 269

 Score =  284 bits (727), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 148/261 (56%), Positives = 184/261 (70%), Gaps = 4/261 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+  L  +G  VL++DLDPQGNASTGLGIE  DR  ++YD
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAGLVELGYRVLVVDLDPQGNASTGLGIEANDRANTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--DF 124
           LLI +  +  ++ +T I +L IIP+T+DL   ++ L   + R F L  AL        D+
Sbjct: 71  LLIGDVALQDVIRETEIEDLCIIPATVDLSSADIELFSNEKRSFLLHDALRQPAMDEYDW 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM A+ S+LVPLQ EFFALEG+SQL+ T+ EVR+T N  L I+
Sbjct: 131 DYILIDCPPSLNLLTVNAMVASHSVLVPLQSEFFALEGVSQLMLTIREVRQTANPNLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN+LSQQV  D R +LG  V+ T IPRNVR+SEAPSY  P + YD    G+
Sbjct: 191 GIVLTMFDRRNNLSQQVEQDARSHLGELVFETKIPRNVRVSEAPSYALPVLNYDTNSLGA 250

Query: 245 QAYLKLASELIQQERHRKEAA 265
            AY  LA ELI   RH+K AA
Sbjct: 251 NAYRALAEELIA--RHQKLAA 269


>gi|149204374|ref|ZP_01881341.1| chromosome partitioning protein ParA [Roseovarius sp. TM1035]
 gi|149142259|gb|EDM30306.1| chromosome partitioning protein ParA [Roseovarius sp. TM1035]
          Length = 269

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 183/253 (72%), Gaps = 4/253 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL+ ALA  G  VL++DLDPQGNASTGLG+++  RK++ YD
Sbjct: 11  KIIAIANQKGGVGKTTTTINLAAALAETGVRVLIVDLDPQGNASTGLGLDVAARKFTVYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD--- 123
           LL++E  +  ++  TA   LSIIPST+DL   ++ L   + R F L  AL  Q   D   
Sbjct: 71  LLLDEAPLGDVIQPTAQDGLSIIPSTVDLSSADIELIANEKRSFLLHDALR-QPAMDAYG 129

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F Y+ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ E+R+T N AL I
Sbjct: 130 FEYVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREIRQTANPALRI 189

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTMFDSRN+LS QV  D R NLG  V+ T IPRNVR+SEAPSY    + YD    G
Sbjct: 190 EGVVLTMFDSRNNLSTQVEQDARDNLGELVFRTRIPRNVRVSEAPSYAMSVLSYDPLSKG 249

Query: 244 SQAYLKLASELIQ 256
           +QAY +LA ELI+
Sbjct: 250 AQAYRELAQELIE 262


>gi|83953079|ref|ZP_00961801.1| chromosome partitioning protein ParA [Sulfitobacter sp. NAS-14.1]
 gi|83842047|gb|EAP81215.1| chromosome partitioning protein ParA [Sulfitobacter sp. NAS-14.1]
          Length = 266

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 145/251 (57%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL+ AL    + VL+IDLDPQGNASTGLGIEL DR++++Y+
Sbjct: 11  KIIAIANQKGGVGKTTTTINLAAALVEQKQRVLVIDLDPQGNASTGLGIELDDREFTTYE 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTS-DF 124
           LL+E+ +++Q+++ T    L I+ +T+DL   +M L   + R F L  AL   Q+ S  F
Sbjct: 71  LLLEDIDLDQVIMTTETEGLYIVAATVDLSSADMELIANEKRSFLLHDALRQTQMDSYAF 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR++ N  L I+
Sbjct: 131 DYILIDCPPSLNLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D RN+LSQQV  D R NLG  VY TVIPRNVR+SEAPSY  P + YD    G+
Sbjct: 191 GILLTMYDQRNNLSQQVEQDARSNLGELVYRTVIPRNVRVSEAPSYAMPVLSYDSGSKGA 250

Query: 245 QAYLKLASELI 255
           +AY  LA E++
Sbjct: 251 KAYRDLAKEVL 261


>gi|77920729|ref|YP_358544.1| partition protein, Par-like [Pelobacter carbinolicus DSM 2380]
 gi|77546812|gb|ABA90374.1| chromosome segregation ATPase [Pelobacter carbinolicus DSM 2380]
          Length = 254

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 188/250 (75%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT+INLS +LA   +  LL+DLDPQ NAS+G+GI   + +Y++Y 
Sbjct: 3   QIIAIANQKGGVGKTTTSINLSASLAVAEKRTLLVDLDPQSNASSGVGIADENIQYTTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L+ +   +Q++  T I  L ++PST DL+G E+ L GE+DR  RL KAL+ Q+ +DF Y
Sbjct: 63  ALLGQVETSQVVTTTGIEFLKVLPSTTDLIGAEIELIGEEDRETRLKKALN-QIRNDFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AADS+LVPLQCE++A+EGLSQL  T++ ++R +N AL + GI
Sbjct: 122 ILIDCPPSLGLLTINALTAADSVLVPLQCEYYAMEGLSQLTRTIDLIQRQLNPALSLCGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN+LS QV  ++R++   +V+ TVIPRNVR+SEAPS+G P + YD+   G++A
Sbjct: 182 LLTMFDGRNNLSHQVSDEIRRHFSERVFKTVIPRNVRLSEAPSHGLPVLQYDISSRGAEA 241

Query: 247 YLKLASELIQ 256
           YL LA ELI 
Sbjct: 242 YLALARELIH 251


>gi|294085215|ref|YP_003551975.1| chromosome partitioning protein ParA [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664790|gb|ADE39891.1| chromosome partitioning protein ParA [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 260

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 193/255 (75%), Gaps = 1/255 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           ++RII +ANQKGGVGKTTT++NL+TALAA G  VLL+D DPQGNASTG GI+   R+++S
Sbjct: 4   EARIIAVANQKGGVGKTTTSVNLATALAACGRKVLLVDFDPQGNASTGFGIDHAQREHNS 63

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y ++I +   +  +  T +P L IIP+ +DL   E+ L     R + L  A++  +  D+
Sbjct: 64  YHVVIGQTPASAAIQGTIVPRLDIIPAVVDLSAAEIELIDVARREYCLADAIAT-VADDY 122

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS  LLT+NA+ AA S+L+PLQCEF+ALEGLSQL+ T++ VR  +N  L++Q
Sbjct: 123 DYVIIDCPPSLGLLTVNALCAAASVLIPLQCEFYALEGLSQLMRTIDAVRGGINPRLEMQ 182

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFDSRN LS+ V +DVR +LG  VYNTVIPRNVR+SEAPS+G+P ++YDLKC G+
Sbjct: 183 GVVLTMFDSRNKLSESVENDVRAHLGAVVYNTVIPRNVRVSEAPSFGQPVLMYDLKCVGA 242

Query: 245 QAYLKLASELIQQER 259
           QAY  LA+EL+ QE+
Sbjct: 243 QAYAALAAELLTQEK 257


>gi|126738502|ref|ZP_01754207.1| chromosome partitioning protein ParA [Roseobacter sp. SK209-2-6]
 gi|126720301|gb|EBA17007.1| chromosome partitioning protein ParA [Roseobacter sp. SK209-2-6]
          Length = 269

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 181/251 (72%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+ AL   G  VL++DLDPQGNASTGLGIE  DR  ++YD
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAALVETGLRVLVVDLDPQGNASTGLGIEAGDRGLTTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+++  + +++  T I +L IIP+T+DL   ++ L   + R F L  AL  +     D+
Sbjct: 71  LLVDDTPLEEVIYATEIEDLCIIPATVDLSSADIELFANEKRSFLLHDALRQTAMDEYDW 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS NLLT+NAM AA S+L+PLQ EFFALEG+SQL+ T+ EVR+  N  L I+
Sbjct: 131 DYVLIDCPPSLNLLTVNAMVAAHSVLIPLQSEFFALEGVSQLMLTIREVRQAANPNLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFD RN+LSQQV  D R+NLG  V+ T IPRNVR+SEAPS+  P + YD    G+
Sbjct: 191 GVVLTMFDRRNNLSQQVEQDARENLGELVFKTKIPRNVRVSEAPSFALPVLNYDSNSLGA 250

Query: 245 QAYLKLASELI 255
           QAY  LA ELI
Sbjct: 251 QAYRALAEELI 261


>gi|209966081|ref|YP_002298996.1| chromosome partitioning ATPase [Rhodospirillum centenum SW]
 gi|209959547|gb|ACJ00184.1| ATPase involved in chromosome partitioning, putative
           [Rhodospirillum centenum SW]
          Length = 274

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 196/258 (75%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTT INL TALAAIG+ VL+ID DPQGNASTGLGI   DR    YD
Sbjct: 16  RVIALANQKGGVGKTTTTINLGTALAAIGKRVLIIDNDPQGNASTGLGISQSDRGIGIYD 75

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL  +  + ++ + T +PNLS++ ++++L G E+ L   + R +RL  AL+ +    + Y
Sbjct: 76  LLFGDSRLEEVTVPTDVPNLSLVTASVELSGAEVELVNVERREYRLKDALA-RSHGGYDY 134

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+  LLT+NA+AAAD++LVPLQCEF+ALEGLS L+ T+E V+R  N ALDIQG+
Sbjct: 135 ILIDCPPALGLLTLNALAAADAVLVPLQCEFYALEGLSHLVRTIERVKRAFNPALDIQGV 194

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN+LS  V +DVR   G KV+ TVIPRNVR+SEAPS+GKP ++YD + AG+QA
Sbjct: 195 VLTMFDRRNNLSDMVAADVRGFFGDKVFETVIPRNVRVSEAPSHGKPVLLYDYRSAGAQA 254

Query: 247 YLKLASELIQQERHRKEA 264
           Y+ LA E++++ER R+ A
Sbjct: 255 YIHLAGEVLKRERKRQLA 272


>gi|163737991|ref|ZP_02145407.1| Cobyrinic acid a,c-diamide synthase [Phaeobacter gallaeciensis
           BS107]
 gi|161388607|gb|EDQ12960.1| Cobyrinic acid a,c-diamide synthase [Phaeobacter gallaeciensis
           BS107]
          Length = 255

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 183/257 (71%), Gaps = 4/257 (1%)

Query: 11  IANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIE 70
           +ANQKGGVGKTTTAINL+ AL   G  VL++DLDPQGNASTGLGIE  DR  ++YDLL++
Sbjct: 1   MANQKGGVGKTTTAINLAAALVETGYRVLVVDLDPQGNASTGLGIEATDRTRTTYDLLVD 60

Query: 71  EKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS--YIF 128
           +  +N ++ +T I +L IIP+T+DL   ++ L   + R F L  AL      D+   Y+ 
Sbjct: 61  DVGLNDVIRETEIEDLCIIPATIDLSSADIELFTNEKRSFLLHDALRQPAMDDYDWDYVL 120

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS NLLT+NAM AA S+LVPLQ EFFALEG+SQL+ T+ EVR+T N  L I+GI+L
Sbjct: 121 IDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGVSQLMLTIREVRQTANPNLRIEGIVL 180

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN+LSQQV  D R +LG  V+ T IPRNVR+SEAPSY  P + YD    G+ AY 
Sbjct: 181 TMYDRRNNLSQQVEQDARGHLGELVFETKIPRNVRVSEAPSYALPVLNYDTNSLGANAYR 240

Query: 249 KLASELIQQERHRKEAA 265
            LA ELI   RH+K AA
Sbjct: 241 ALAEELIA--RHQKLAA 255


>gi|163742613|ref|ZP_02149999.1| chromosome partitioning protein ParA [Phaeobacter gallaeciensis
           2.10]
 gi|161384198|gb|EDQ08581.1| chromosome partitioning protein ParA [Phaeobacter gallaeciensis
           2.10]
          Length = 255

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 183/257 (71%), Gaps = 4/257 (1%)

Query: 11  IANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIE 70
           +ANQKGGVGKTTTAINL+ AL   G  VL++DLDPQGNASTGLGIE  DR  ++YDLL++
Sbjct: 1   MANQKGGVGKTTTAINLAAALVETGYRVLVVDLDPQGNASTGLGIEATDRTRTTYDLLVD 60

Query: 71  EKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS--YIF 128
           +  +N ++ +T I +L IIP+T+DL   ++ L   + R F L  AL      D+   Y+ 
Sbjct: 61  DVALNDVIRETEIEDLCIIPATVDLSSADIELFTNEKRSFLLHDALRQPAMDDYDWDYVL 120

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS NLLT+NAM AA S+LVPLQ EFFALEG+SQL+ T+ EVR+T N  L I+GI+L
Sbjct: 121 IDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGVSQLMLTIREVRQTANPNLRIEGIVL 180

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D RN+LSQQV  D R +LG  V+ T IPRNVR+SEAPSY  P + YD    G+ AY 
Sbjct: 181 TMYDRRNNLSQQVEQDARGHLGELVFETKIPRNVRVSEAPSYALPVLNYDTNSLGANAYR 240

Query: 249 KLASELIQQERHRKEAA 265
            LA ELI   RH+K AA
Sbjct: 241 ALAEELIA--RHQKLAA 255


>gi|86136759|ref|ZP_01055337.1| chromosome partitioning protein ParA [Roseobacter sp. MED193]
 gi|85826083|gb|EAQ46280.1| chromosome partitioning protein ParA [Roseobacter sp. MED193]
          Length = 269

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 182/251 (72%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+ AL   G  VL++DLDPQGNASTGLGI+  DR  ++YD
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAALVETGLRVLVVDLDPQGNASTGLGIDSTDRDATTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+++  +N+++  T I +L IIP+T+DL   ++ L   + R F L  AL  +     D+
Sbjct: 71  LLVDDAPLNEVIRTTDIEDLCIIPATVDLSSADIELFANEKRSFLLHDALRQTAMDEYDW 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS NLLT+NAM A+ S+L+PLQ EFFALEG+SQLL T+ EVR++ N  L I+
Sbjct: 131 DYVLIDCPPSLNLLTVNAMVASHSVLIPLQSEFFALEGVSQLLLTIREVRQSANPGLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN+LSQQV  D R NLG  V+ T IPRNVR+SEAPSY  P + YD    G+
Sbjct: 191 GIVLTMFDRRNNLSQQVEQDARDNLGELVFKTKIPRNVRVSEAPSYALPVLNYDGNSLGA 250

Query: 245 QAYLKLASELI 255
           +AY  LA ELI
Sbjct: 251 RAYRALAEELI 261


>gi|125974862|ref|YP_001038772.1| chromosome segregation ATPase [Clostridium thermocellum ATCC 27405]
 gi|256003882|ref|ZP_05428869.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum DSM
           2360]
 gi|281418672|ref|ZP_06249691.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum JW20]
 gi|125715087|gb|ABN53579.1| chromosome segregation ATPase [Clostridium thermocellum ATCC 27405]
 gi|255992220|gb|EEU02315.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum DSM
           2360]
 gi|281407756|gb|EFB38015.1| Cobyrinic acid ac-diamide synthase [Clostridium thermocellum JW20]
 gi|316939073|gb|ADU73107.1| cobyrinic acid ac-diamide synthase [Clostridium thermocellum DSM
           1313]
          Length = 258

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 188/251 (74%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTTTA+NLS+ LA  G+ VL++D+DPQGN ++GLGI+      S Y
Sbjct: 2   SKVIAVANQKGGVGKTTTAVNLSSCLAYKGKKVLILDIDPQGNTTSGLGIDKKKINKSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E +IN +L+ T + NL + PS ++L G E+ L     R  RL  AL   + +D+ 
Sbjct: 62  DILINEADINDVLVDTPVENLKLCPSNIELAGAEVELVSSISRETRLKSALE-PVRNDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+N++ AAD ILVP+QCE++ALEGLSQL+ETV+ V++ +N  LD++G
Sbjct: 121 FILIDCPPSLGLLTLNSLTAADKILVPIQCEYYALEGLSQLMETVKLVQKHLNKNLDVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY T+IPRNVR+SEAPS+G P I+YD K  G++
Sbjct: 181 VVLTMFDARTNLSIQVVEEVKKYFKNKVYRTIIPRNVRLSEAPSFGLPIILYDPKSKGAE 240

Query: 246 AYLKLASELIQ 256
            YL+LA E+I+
Sbjct: 241 CYLELADEVIE 251


>gi|260428989|ref|ZP_05782966.1| chromosome partitioning protein ParA [Citreicella sp. SE45]
 gi|260419612|gb|EEX12865.1| chromosome partitioning protein ParA [Citreicella sp. SE45]
          Length = 269

 Score =  281 bits (718), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 141/253 (55%), Positives = 187/253 (73%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL  ALA  G  VL++DLDPQGN+STGLGIE  DR++++Y+
Sbjct: 11  KIIAIANQKGGVGKTTTTINLGAALAEKGLKVLVVDLDPQGNSSTGLGIEPDDRQFTTYE 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+E+  + +I+ +T   NL +IP+T+DL   ++ L   + R F L  AL  S      +
Sbjct: 71  LLLEDATLEEIIQKTDQENLFLIPATVDLSSADVELVANEKRSFLLRDALRQSGMAQYGY 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR++ N+ L I+
Sbjct: 131 DYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSANTGLRIE 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+DSRN+LS+QV  D R NLG  V++TVIPRNVR+SEAPS+  P + YD +  G+
Sbjct: 191 GVVLTMYDSRNNLSRQVEDDARANLGDLVFSTVIPRNVRVSEAPSFAMPVLTYDGQSKGA 250

Query: 245 QAYLKLASELIQQ 257
            AY  LA EL+++
Sbjct: 251 LAYRALAEELLRK 263


>gi|84684650|ref|ZP_01012551.1| chromosome partitioning protein ParA [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667629|gb|EAQ14098.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           HTCC2654]
          Length = 259

 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 139/254 (54%), Positives = 177/254 (69%), Gaps = 2/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II + NQKGGVGKTTTAINL  ALA  G  VL++DLDPQGNASTGLGIE  DR+ ++Y
Sbjct: 4   AKIIAVTNQKGGVGKTTTAINLGAALAMKGNKVLIVDLDPQGNASTGLGIEPQDRESTTY 63

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--D 123
           DLL+EE  +  +++QT I NL I P+T DL   ++ L   + R   L  +L         
Sbjct: 64  DLLLEESPLESVVLQTVIENLWIAPATTDLSSADIELVANEKRSHLLHDSLRAPTAERLG 123

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             YI +DCPPS NLLT+NA+ AA S+L+PLQ EFFALEGLSQL+ T+ EVR   N  L I
Sbjct: 124 LDYILIDCPPSLNLLTVNALVAAHSVLIPLQSEFFALEGLSQLMLTIREVREAANPKLRI 183

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTM D RN+L+QQV +D R  LG  V+ TV+PRNVR+SEAPS+  P I YD    G
Sbjct: 184 EGVVLTMHDMRNNLAQQVEADARDTLGELVFKTVVPRNVRVSEAPSFAMPVISYDPSSKG 243

Query: 244 SQAYLKLASELIQQ 257
           SQAY+ LA EL+ +
Sbjct: 244 SQAYISLAQELMAK 257


>gi|114769776|ref|ZP_01447386.1| chromosome partitioning protein ParA [alpha proteobacterium
           HTCC2255]
 gi|114549481|gb|EAU52363.1| chromosome partitioning protein ParA [alpha proteobacterium
           HTCC2255]
          Length = 261

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 190/263 (72%), Gaps = 2/263 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  K  R+++IANQKGGVGKTTTAIN++ A+A  G  VL++DLDPQGNASTGLGI   DR
Sbjct: 1   MPVKLKRVVSIANQKGGVGKTTTAINMAAAIARNGHKVLVVDLDPQGNASTGLGISPDDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           ++++YD+L++  +I + +++T + NLSI+ S  DL   +  L  +K RL RL  +L  + 
Sbjct: 61  EFTAYDVLVDGVDIQKAIVETNVKNLSIVTSNTDLSSADAELMNDKGRLIRLRNSL--EG 118

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F YIF+DCPPS NLLT+NA AA+DS+LVPLQ EF+ALEGLSQL+ TV EVR  + + 
Sbjct: 119 IRHFDYIFIDCPPSLNLLTINAFAASDSVLVPLQSEFYALEGLSQLILTVREVREALGTE 178

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I G++LTMFD R  L+QQV  DVR NL   VY T+IPR VR+SEAPSYG+  + YD  
Sbjct: 179 LFIDGVVLTMFDRRVKLAQQVEIDVRDNLKSLVYKTIIPRTVRLSEAPSYGETILEYDAL 238

Query: 241 CAGSQAYLKLASELIQQERHRKE 263
             G++AY+ L  E +++++ +++
Sbjct: 239 GRGAEAYIALGDEFLKRDKKKQK 261


>gi|254453782|ref|ZP_05067219.1| chromosome partitioning protein ParA [Octadecabacter antarcticus
           238]
 gi|198268188|gb|EDY92458.1| chromosome partitioning protein ParA [Octadecabacter antarcticus
           238]
          Length = 272

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/264 (54%), Positives = 184/264 (69%), Gaps = 4/264 (1%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
            + K RI+++ANQKGGVGKTTT INL  ALA  G  VLLIDLDPQGNASTGLGIEL DR 
Sbjct: 5   RKTKPRILSVANQKGGVGKTTTTINLGAALARAGRRVLLIDLDPQGNASTGLGIELADRN 64

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            ++YDLL  +   +  +  T++ NL IIP+T DL   ++ L   + R F L  AL  Q  
Sbjct: 65  ITTYDLLTGDVMPSDAVKNTSVENLLIIPATTDLSSADINLMANEKRSFMLHDALH-QPD 123

Query: 122 SD---FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
            D     YI +DCPPS N+LT+NAM A+D+++VPLQ EFFALEGLSQL+ T+ ++R+T  
Sbjct: 124 IDSLALDYILIDCPPSLNILTVNAMIASDAVVVPLQSEFFALEGLSQLMLTIRDIRQTAK 183

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
            +L I+G++LTM+D RN+L QQV +D R NLG  V+ TVIPRNVR+SEAPS+  P I YD
Sbjct: 184 PSLRIEGVVLTMYDKRNNLCQQVEADARGNLGDLVFETVIPRNVRLSEAPSFALPIIDYD 243

Query: 239 LKCAGSQAYLKLASELIQQERHRK 262
               GS AY  LA E+I +ER  K
Sbjct: 244 PASKGSHAYHALAKEIIDRERTPK 267


>gi|56694931|ref|YP_165276.1| chromosome partitioning protein ParA [Ruegeria pomeroyi DSS-3]
 gi|56676668|gb|AAV93334.1| chromosome partitioning protein ParA [Ruegeria pomeroyi DSS-3]
          Length = 267

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 143/261 (54%), Positives = 189/261 (72%), Gaps = 6/261 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+ AL   G+ VL++DLDPQGNASTGLG++  +R+ ++Y+
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAALVESGQRVLVVDLDPQGNASTGLGVD--ERELTTYE 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS- 125
           LL+++  +N ++ +T+I  LSI+P+T+DL   ++ L   + R F L  AL       +S 
Sbjct: 69  LLVDDAPLNSVIQKTSIDGLSIVPATVDLSSADIELISNEKRSFLLHDALRQTAMDAYSW 128

Query: 126 -YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+  N  L I+
Sbjct: 129 DYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQAANPNLRIE 188

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTM+D RN+LSQQV  D R NLG  V+ T IPRNVR+SEAPS+  P + YD    G+
Sbjct: 189 GIVLTMYDRRNNLSQQVEKDARDNLGDLVFETKIPRNVRVSEAPSFAMPVLNYDPNSLGA 248

Query: 245 QAYLKLASELIQQERHRKEAA 265
            AY  LA+EL++  +H K AA
Sbjct: 249 MAYRDLAAELMK--KHNKIAA 267


>gi|126734411|ref|ZP_01750158.1| chromosome partitioning protein ParA [Roseobacter sp. CCS2]
 gi|126717277|gb|EBA14141.1| chromosome partitioning protein ParA [Roseobacter sp. CCS2]
          Length = 265

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/260 (55%), Positives = 182/260 (70%), Gaps = 2/260 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL  ALA   + VLLIDLDPQGNASTGLGI+   R  ++YD
Sbjct: 6   KIIAIANQKGGVGKTTTTINLGAALAEQNKRVLLIDLDPQGNASTGLGIDHDKRDATTYD 65

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS--DF 124
           LL  +  +++ + +T++ +LSIIP+T DL   ++ L     R F L   L        DF
Sbjct: 66  LLSGDVTLSEAVQKTSVDHLSIIPATTDLSSADLELVDNAKRSFLLRDVLRASSAEALDF 125

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS N+LT+NAM AA SI+VPLQ EFFALEGLSQL+ TV +VR+T N  L I+
Sbjct: 126 DYILIDCPPSLNILTVNAMVAAQSIIVPLQSEFFALEGLSQLILTVRDVRQTANPDLRIE 185

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI LTM+DSRN+LS QV  D R+N+G  V+ TVIPRNVR+SEAPS+  P + YD    GS
Sbjct: 186 GIALTMYDSRNNLSLQVEDDARENMGDMVFKTVIPRNVRLSEAPSFAIPVLTYDSGSKGS 245

Query: 245 QAYLKLASELIQQERHRKEA 264
            AY  LA ELI++E+  + A
Sbjct: 246 TAYRSLAKELIEKEKKMRAA 265


>gi|89067427|ref|ZP_01154940.1| chromosome partitioning protein ParA [Oceanicola granulosus
           HTCC2516]
 gi|89046996|gb|EAR53050.1| chromosome partitioning protein ParA [Oceanicola granulosus
           HTCC2516]
          Length = 265

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 143/256 (55%), Positives = 179/256 (69%), Gaps = 2/256 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  RII IANQKGGVGKTTTAINL  AL+  G  VL++D+DPQGNASTGLG+E   R+ S
Sbjct: 8   RGPRIIAIANQKGGVGKTTTAINLGAALSHAGHTVLIVDIDPQGNASTGLGVEADARETS 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            YD+L+ E  +   +  T + +L IIP+T DL   ++ L   + R F L  AL       
Sbjct: 68  IYDVLLGEAELADTIRSTEVGDLLIIPATTDLSSADIELISTEKRSFLLHDALRQPAVDR 127

Query: 124 FS--YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           F+  Y+ +DCPPS NLLT+NA+ AADS+LVPLQ EFFALEGLSQL+ TV EVR T N  L
Sbjct: 128 FALDYVLIDCPPSLNLLTVNALVAADSVLVPLQSEFFALEGLSQLMLTVREVRETANPRL 187

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G+ LTM+D RN+LSQQV  D R+NLG  V+ TVIPRNVR+SEAPS+  P + YD   
Sbjct: 188 RIEGVALTMYDKRNNLSQQVEEDARENLGDLVFQTVIPRNVRLSEAPSFAMPVLDYDPSS 247

Query: 242 AGSQAYLKLASELIQQ 257
            G+QAY  LA+ELI +
Sbjct: 248 RGAQAYQALAAELIAR 263


>gi|260431967|ref|ZP_05785938.1| chromosome partitioning protein ParA [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415795|gb|EEX09054.1| chromosome partitioning protein ParA [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 267

 Score =  278 bits (712), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 184/255 (72%), Gaps = 4/255 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+  LA  G  VL++DLDPQGNASTGLG+E  DR +++YD
Sbjct: 11  RIIAVANQKGGVGKTTTAINLAAGLAEAGCKVLVVDLDPQGNASTGLGVE--DRDWTTYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS- 125
           L+++E  +  ++ +T I N+ IIP+T+DL   ++ L   + R++ L  AL       F  
Sbjct: 69  LILDEAPLEAVVQETEIDNVCIIPATVDLSSADIELISNEKRIYLLHDALRQPAIDTFGL 128

Query: 126 -YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            ++ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L I+
Sbjct: 129 DFVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTANPDLRIE 188

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D+RN+LS+QV  D R NLG  V+ T IPRNVR+SEAPS+  P + YD    G+
Sbjct: 189 GVVLTMYDNRNNLSRQVEKDARDNLGEMVFKTKIPRNVRVSEAPSFAMPVLQYDSGSLGA 248

Query: 245 QAYLKLASELIQQER 259
            AY  LA E++Q+ R
Sbjct: 249 MAYRHLAREILQKNR 263


>gi|260576112|ref|ZP_05844105.1| Cobyrinic acid ac-diamide synthase [Rhodobacter sp. SW2]
 gi|259021592|gb|EEW24895.1| Cobyrinic acid ac-diamide synthase [Rhodobacter sp. SW2]
          Length = 275

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 187/265 (70%), Gaps = 6/265 (2%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  RII +ANQKGGVGKTTTAINL+  LA +G  VLL+DLDPQGNASTG+GI+   R+ +
Sbjct: 8   KLPRIIAVANQKGGVGKTTTAINLAAGLAELGAKVLLVDLDPQGNASTGVGIDAGHRRLT 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           +YDL++++  + +++ QT I  LSI P+  DL   +M L   + R F L  AL  Q   D
Sbjct: 68  TYDLMLDDAPLAEVIQQTKIDRLSISPANTDLSSADMELVSNEKRSFLLHDALR-QTAMD 126

Query: 124 ---FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F++I +DCPPS NLLT+NA+ A  S+LVPLQ EFFALEGLSQL+ TV EVR+T N+ 
Sbjct: 127 ALGFNFIVIDCPPSLNLLTINALVACHSVLVPLQAEFFALEGLSQLMLTVREVRQTANAD 186

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I+G++LTM DSRN+LSQQV +D R+NLG  V+ TVIPRNVR+SEAPS+  P + YD  
Sbjct: 187 LRIEGVLLTMADSRNNLSQQVEADARQNLGDLVFKTVIPRNVRLSEAPSFALPVLAYDTA 246

Query: 241 CAGSQAYLKLASELIQQERHRKEAA 265
             GS AY  L+ E+    RH   AA
Sbjct: 247 SRGSLAYRALSLEI--AARHGIGAA 269


>gi|254461950|ref|ZP_05075366.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           HTCC2083]
 gi|206678539|gb|EDZ43026.1| chromosome partitioning protein ParA [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 269

 Score =  278 bits (711), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 137/254 (53%), Positives = 186/254 (73%), Gaps = 2/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ + NQKGGVGKTTT INL+ +L A G  VL+IDLDPQGNASTGLGI+   R+ ++Y
Sbjct: 10  TKIVAVVNQKGGVGKTTTTINLAASLVAEGLRVLIIDLDPQGNASTGLGIDARSRELTTY 69

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD-- 123
           +LL+++  + +++ +T    L I+P+T+DL   ++ L   + R F L  AL   L  D  
Sbjct: 70  ELLLDDVTLEEVIQKTKTDGLMIVPATIDLSSADIELMANEKRSFLLHDALRQPLMDDYD 129

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F +I +DCPPS NLLT+NAM A+ S+LVPLQ EFFALEGLSQL+ TV EVR+T N  L I
Sbjct: 130 FDFILIDCPPSLNLLTVNAMVASHSVLVPLQSEFFALEGLSQLMLTVREVRQTANPDLRI 189

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTMFD+RN+LSQQV +D R+NLG  V+ T IPRNVR+SEAPS+  P + YD    G
Sbjct: 190 EGVVLTMFDARNNLSQQVENDARENLGEMVFKTKIPRNVRVSEAPSFALPVLDYDPASKG 249

Query: 244 SQAYLKLASELIQQ 257
           +QAY +LA E+I++
Sbjct: 250 AQAYNELAREVIEK 263


>gi|254510583|ref|ZP_05122650.1| chromosome partitioning protein ParA [Rhodobacteraceae bacterium
           KLH11]
 gi|221534294|gb|EEE37282.1| chromosome partitioning protein ParA [Rhodobacteraceae bacterium
           KLH11]
          Length = 267

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 182/251 (72%), Gaps = 4/251 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ +ANQKGGVGKTTTAINL+  LA  G  VL++DLDPQGNASTGLG+E  DR +++YD
Sbjct: 11  RIVAVANQKGGVGKTTTAINLAAGLAEAGCKVLVVDLDPQGNASTGLGVE--DRDWTTYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--TSDF 124
           L+++E  +  ++ +T I NL ++P+T+DL   ++ L   + R + L  AL      T D 
Sbjct: 69  LILDEAPLEAVVQETEIDNLFVVPATVDLSSADIELISNEKRSYLLHDALRQTAIDTFDL 128

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            ++ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR+T N  L I+
Sbjct: 129 DFVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIREVRQTANPDLRIE 188

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D+RN+LS+QV  D R NLGG V+ T IPRNVR+SEAPSY  P + YD    G+
Sbjct: 189 GVVLTMYDNRNNLSRQVEKDARDNLGGMVFKTKIPRNVRVSEAPSYALPVLQYDSGSLGA 248

Query: 245 QAYLKLASELI 255
            AY  LA E++
Sbjct: 249 MAYRHLAREVM 259


>gi|302035747|ref|YP_003796069.1| chromosomal partitioning ATPase ParA [Candidatus Nitrospira
           defluvii]
 gi|300603811|emb|CBK40143.1| Chromosomal partitioning ATPase ParA [Candidatus Nitrospira
           defluvii]
          Length = 258

 Score =  277 bits (708), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 191/250 (76%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII +ANQKGGVGKTTT++NL+ ALA  G +VLL+D+DPQGNA++GLG++      + Y
Sbjct: 2   ARIIAVANQKGGVGKTTTSVNLAAALAIEGGSVLLVDIDPQGNATSGLGVDAMSLTKTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI +++I  + +QT +  LSI+P+   L G E+ L   +DR  RL +AL+  ++  + 
Sbjct: 62  NVLISKESIESLAMQTGVNGLSIVPANSHLAGAEVELVNMEDREQRLKEALA-DVSDRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
            I LDCPP+  LLT+NAM AA S+L+P+QCE++A+EGL +L+E+++ +R+++N  L+I+G
Sbjct: 121 TILLDCPPALGLLTINAMVAAHSVLIPVQCEYYAMEGLGRLMESIQRLRQSLNPGLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D+RNSL++QVV  +R + G  VY T+IPRNV ++EAPSYG+PA++Y++  AG+Q
Sbjct: 181 IVLTMYDARNSLARQVVEQIRGHFGASVYQTMIPRNVTLAEAPSYGRPALLYNMASAGAQ 240

Query: 246 AYLKLASELI 255
           AYL LA E +
Sbjct: 241 AYLSLAKEFV 250


>gi|212640673|ref|YP_002317193.1| chromosome partitioning ATPase [Anoxybacillus flavithermus WK1]
 gi|212562153|gb|ACJ35208.1| ATPase involved in chromosome partitioning, soj [Anoxybacillus
           flavithermus WK1]
          Length = 257

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 185/249 (74%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTTA+NLS  LA +G+  LL+D+DPQGNA++G+G+E +D +  +YD
Sbjct: 7   KIIAIANQKGGVGKTTTAVNLSACLAHMGKKTLLVDVDPQGNATSGIGVEKHDIEQCAYD 66

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE ++ Q++  T I  L IIP+T+ L G E+ L     R  RL KALS  +   + +
Sbjct: 67  LLVEEVDVRQVIRPTNIERLHIIPATIQLAGAEIELVPIVSREVRLQKALS-PIKDVYDF 125

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ +AD++L+P+QCE++ALEGLSQLL T+  V++ +NS L I+G+
Sbjct: 126 IIIDCPPSLGLLTINALTSADTVLIPVQCEYYALEGLSQLLNTIRLVQKHLNSNLRIEGV 185

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD K  G++ 
Sbjct: 186 LLTMFDARTNLGIQVIQEVKKYFREKVYETIIPRNVRLSEAPSHGKPIILYDAKSRGAEV 245

Query: 247 YLKLASELI 255
           Y   A E+I
Sbjct: 246 YADFAKEVI 254


>gi|58696833|ref|ZP_00372357.1| ParA family protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|58698194|ref|ZP_00373115.1| SpoOJ regulator protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|99035089|ref|ZP_01314877.1| hypothetical protein Wendoof_01000283 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225630882|ref|YP_002727673.1| Chromosome partitioning protein, ParA family [Wolbachia sp. wRi]
 gi|58535275|gb|EAL59353.1| SpoOJ regulator protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58536963|gb|EAL60125.1| ParA family protein [Wolbachia endosymbiont of Drosophila simulans]
 gi|225592863|gb|ACN95882.1| Chromosome partitioning protein, ParA family [Wolbachia sp. wRi]
          Length = 280

 Score =  276 bits (705), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 147/274 (53%), Positives = 191/274 (69%), Gaps = 31/274 (11%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II I NQKGGVGKTTT+INLSTA AA+G++ LL+DLDPQGNASTGLGI    R     
Sbjct: 2   SKIIAIVNQKGGVGKTTTSINLSTAFAAVGKSTLLVDLDPQGNASTGLGISYRSR----- 56

Query: 66  DLLIEEKNINQILIQT-------------AIPNLSIIPSTMDLLGIEMILGGEKDRLFRL 112
               EEKNI +IL+ +              IPNLS+I S +DL   E+ L   +   F L
Sbjct: 57  ----EEKNIYKILLSSENKLIESAIFNIKEIPNLSLISSVVDLSAAEIELSQLERGKFVL 112

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
             AL  ++  ++ YI +DCPPS  LLT+NA+ AA+SI+VPLQCEFFALEGLS L++TVE 
Sbjct: 113 KSALE-KIRDNYEYIIIDCPPSLGLLTINALTAANSIIVPLQCEFFALEGLSHLVKTVEL 171

Query: 173 VRR-TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN-------TVIPRNVRI 224
           ++R  +N  L I+GI+LTM+D RN LS+Q+ +D+ + L  KVY        TVIPRNVR+
Sbjct: 172 IKRNNLNPFLAIEGIVLTMYDRRNKLSEQIKNDICQYLNDKVYKTIIPLYETVIPRNVRL 231

Query: 225 SEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQE 258
           SEAPS+GKPAI+YDLKC G+QAY+ LA E++++ 
Sbjct: 232 SEAPSHGKPAIVYDLKCPGAQAYISLAREILKKH 265


>gi|225677204|ref|ZP_03788197.1| Chromosome partitioning protein, ParA family [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590728|gb|EEH11962.1| Chromosome partitioning protein, ParA family [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 280

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 191/274 (69%), Gaps = 31/274 (11%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+I+ I NQKGGVGKTTT+INLSTA AA+G++ LL+DLDPQGNASTGLGI    R     
Sbjct: 2   SKIVAIVNQKGGVGKTTTSINLSTAFAAVGKSTLLVDLDPQGNASTGLGISYRSR----- 56

Query: 66  DLLIEEKNINQILIQT-------------AIPNLSIIPSTMDLLGIEMILGGEKDRLFRL 112
               EEKNI +IL+ +              IPNLS+I S +DL   E+ L   +   F L
Sbjct: 57  ----EEKNIYKILLSSENRLIESAIFNIKEIPNLSLISSVVDLSAAEIELSQLERGKFVL 112

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
             AL  ++  ++ YI +DCPPS  LLT+NA+ AA+SI+VPLQCEFFALEGLS L++TVE 
Sbjct: 113 KSALE-KIRDNYEYIIIDCPPSLGLLTINALTAANSIIVPLQCEFFALEGLSHLVKTVEL 171

Query: 173 VRR-TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN-------TVIPRNVRI 224
           ++R  +N  L I+GI+LTM+D RN LS+Q+ +D+ + L  KVY        TVIPRNVR+
Sbjct: 172 IKRNNLNPFLAIEGIVLTMYDRRNKLSEQIKNDICQYLNDKVYKTIIPLYETVIPRNVRL 231

Query: 225 SEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQE 258
           SEAPS+GKPAI+YDLKC G+QAY+ LA E++++ 
Sbjct: 232 SEAPSHGKPAIVYDLKCPGAQAYISLAREILKKH 265


>gi|42521014|ref|NP_966929.1| ParA family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410755|gb|AAS14863.1| ParA family protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 280

 Score =  275 bits (704), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 147/274 (53%), Positives = 191/274 (69%), Gaps = 31/274 (11%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II I NQKGGVGKTTT+INLSTA AA+G++ LL+DLDPQGNASTGLGI    R     
Sbjct: 2   SKIIAIVNQKGGVGKTTTSINLSTAFAAVGKSTLLVDLDPQGNASTGLGISYRSR----- 56

Query: 66  DLLIEEKNINQILIQT-------------AIPNLSIIPSTMDLLGIEMILGGEKDRLFRL 112
               EEKNI +IL+ +              IPNLS+I S +DL   E+ L   +   F L
Sbjct: 57  ----EEKNIYKILLSSENKLIESAIFNIKEIPNLSLISSVVDLSAAEIELSQLERGKFVL 112

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
             AL  ++  ++ YI +DCPPS  LLT+NA+ AA+SI+VPLQCEFFALEGLS L++TVE 
Sbjct: 113 KSALE-KIRDNYEYIIIDCPPSLGLLTINALNAANSIIVPLQCEFFALEGLSHLVKTVEL 171

Query: 173 VRR-TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN-------TVIPRNVRI 224
           ++R  +N  L I+GI+LTM+D RN LS+Q+ +D+ + L  KVY        TVIPRNVR+
Sbjct: 172 IKRNNLNPFLAIEGIVLTMYDRRNKLSEQIKNDICQYLNDKVYKTIIPLYETVIPRNVRL 231

Query: 225 SEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQE 258
           SEAPS+GKPAI+YDLKC G+QAY+ LA E++++ 
Sbjct: 232 SEAPSHGKPAIVYDLKCPGAQAYISLAREILKKH 265


>gi|291521116|emb|CBK79409.1| ATPases involved in chromosome partitioning [Coprococcus catus
           GD/7]
          Length = 259

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 192/253 (75%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRII +ANQKGGVGKTTTAINLS  LA   + VL +D+DPQGN ++GLG++    + + Y
Sbjct: 2   SRIIAVANQKGGVGKTTTAINLSACLAEKNKKVLTLDMDPQGNTTSGLGVDKNQAENTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L+++E  +++ +  + + NLS+IPS ++L G E+ L G +++ + L   L + + SD+ 
Sbjct: 62  ELILDESELSECIYPSVMENLSVIPSNINLSGAEIELIGFENKEYLLKSKLDM-IRSDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS NLLT+NAMAAADS++VP+QCE++ALEGLSQL+ T++ ++  +N  L+I+G
Sbjct: 121 YIIIDCPPSLNLLTINAMAAADSVIVPIQCEYYALEGLSQLIHTIDLIKERLNPKLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D+R +LS QVV +V++NL   +Y T+IPRNVR++EAPSYG P  +YD + AG++
Sbjct: 181 VVFTMYDARTNLSLQVVENVKENLDKNIYKTIIPRNVRLAEAPSYGMPINMYDSRSAGAE 240

Query: 246 AYLKLASELIQQE 258
           AY  LA E+I++E
Sbjct: 241 AYRYLAEEVIEKE 253


>gi|190571361|ref|YP_001975719.1| Chromosome partitioning protein,ParA family [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|213018759|ref|ZP_03334567.1| Chromosome partitioning protein,ParA family [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
 gi|190357633|emb|CAQ55075.1| Chromosome partitioning protein,ParA family [Wolbachia endosymbiont
           of Culex quinquefasciatus Pel]
 gi|212995710|gb|EEB56350.1| Chromosome partitioning protein,ParA family [Wolbachia endosymbiont
           of Culex quinquefasciatus JHB]
          Length = 280

 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 191/274 (69%), Gaps = 31/274 (11%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II I NQKGGVGKTTT+INLSTA AA+G++ LL+DLDPQGNASTGLGI    R     
Sbjct: 2   SKIIAIVNQKGGVGKTTTSINLSTAFAAVGKSTLLVDLDPQGNASTGLGISYRSR----- 56

Query: 66  DLLIEEKNINQILIQT-------------AIPNLSIIPSTMDLLGIEMILGGEKDRLFRL 112
               EEKNI +IL+ +              IPNLS+I S +DL   E+ L   +   F L
Sbjct: 57  ----EEKNIYKILLSSESELVESAIFNIKEIPNLSLISSVVDLSAAEIELSQLEQGKFVL 112

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
              L  ++ +++ YI +DCPPS  LLT+NA+ AADSI+VPLQCEFFALEGLS L++TVE 
Sbjct: 113 KDTLE-KVRNNYEYIIIDCPPSLGLLTINALTAADSIIVPLQCEFFALEGLSHLVKTVEL 171

Query: 173 VRR-TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN-------TVIPRNVRI 224
           ++R  +N  L I+GI+LTM+D RN LS+Q+ +D+ + L  KVY        T+IPRNVR+
Sbjct: 172 IKRNNLNPFLLIEGILLTMYDRRNKLSEQIKNDICQYLNDKVYKTIIPLYETIIPRNVRL 231

Query: 225 SEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQE 258
           SEAPS+GKPAI+YDLKC G+QAY+ LA E++++ 
Sbjct: 232 SEAPSHGKPAIVYDLKCPGAQAYISLAKEILKKH 265


>gi|258512899|ref|YP_003186333.1| Cobyrinic acid ac-diamide synthase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479625|gb|ACV59944.1| Cobyrinic acid ac-diamide synthase [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 255

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 187/252 (74%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I IANQKGGVGKTTTA+NL   LA +G+ VLLID+DPQGN ++G+GI   D KY  Y
Sbjct: 4   ARVIAIANQKGGVGKTTTAVNLGACLATLGKRVLLIDIDPQGNTTSGVGINKADVKYCVY 63

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I + NI   ++ + + NL ++P+T+ L G E+ L     R  RL +A+   + S + 
Sbjct: 64  DVIINDVNIADAIMPSGLDNLDVLPATIQLAGAEIELVPTISREVRLRRAIQ-GMRSRYD 122

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N++L+++G
Sbjct: 123 YIVIDCPPSLGLLTVNALTAADSVMIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLEVEG 182

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ DV+K    KVY T+IPRNVR+SEAPS+G+P I YD K  G++
Sbjct: 183 VVLTMLDARTNLGLQVIEDVKKFFRDKVYKTIIPRNVRLSEAPSHGRPIIHYDPKSRGAE 242

Query: 246 AYLKLASELIQQ 257
           +Y++LA E+I +
Sbjct: 243 SYMELAKEVIAR 254


>gi|297618518|ref|YP_003703677.1| cobyrinic acid ac-diamide synthase [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297146355|gb|ADI03112.1| Cobyrinic acid ac-diamide synthase [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 253

 Score =  274 bits (701), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 189/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            R+I IANQKGGVGKTTTA+NLS+ LA  G+ VLL+D+DPQGNA++GLGI+    +   Y
Sbjct: 2   GRVIAIANQKGGVGKTTTAVNLSSCLALEGKKVLLVDIDPQGNATSGLGIDRRKIQSCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+EE     ++++T + NL ++P+T+ L G E+ L G   R FRL K L   +  ++ 
Sbjct: 62  NVLMEELAAQGVVVRTRVRNLDVLPATIQLAGAEVELAGMDAREFRLRKGLE-NIRRNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++++DCPPS  LLT+NA+AAADS+++P+QCE++ALEGLSQL+ T+  +++ +N  L ++G
Sbjct: 121 FVYIDCPPSLGLLTVNALAAADSVMIPIQCEYYALEGLSQLMHTITLIKKRINPGLQLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QVV +V+++   ++Y T+IPRNVR+SEAPSYGKP ++YD +  G++
Sbjct: 181 VLLTMFDGRTNLSIQVVDEVKRHFRRQMYKTIIPRNVRLSEAPSYGKPIVLYDARSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y  LA E++++
Sbjct: 241 VYQDLAKEVLER 252


>gi|218291084|ref|ZP_03495107.1| Cobyrinic acid ac-diamide synthase [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218238969|gb|EED06176.1| Cobyrinic acid ac-diamide synthase [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 255

 Score =  274 bits (701), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 187/252 (74%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I IANQKGGVGKTTTA+NL   LA +G+ VLLID+DPQGN ++G+GI   D KY  Y
Sbjct: 4   ARVIAIANQKGGVGKTTTAVNLGACLAMLGKRVLLIDIDPQGNTTSGVGINKADVKYCVY 63

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I + NI   ++ + + NL ++P+T+ L G E+ L     R  RL +A+   + S + 
Sbjct: 64  DVIINDVNIADAIMPSGLDNLDVLPATIQLAGAEIELVPTISREVRLRRAIQ-GMRSRYD 122

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N++L+++G
Sbjct: 123 YIVIDCPPSLGLLTVNALTAADSVMIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLEVEG 182

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ DV+K    KVY T+IPRNVR+SEAPS+G+P I YD K  G++
Sbjct: 183 VVLTMLDARTNLGLQVIEDVKKFFRDKVYKTIIPRNVRLSEAPSHGRPIIHYDPKSRGAE 242

Query: 246 AYLKLASELIQQ 257
           +Y++LA E+I +
Sbjct: 243 SYMELAKEVIAR 254


>gi|326202778|ref|ZP_08192645.1| cobyrinic acid ac-diamide synthase [Clostridium papyrosolvens DSM
           2782]
 gi|325986855|gb|EGD47684.1| cobyrinic acid ac-diamide synthase [Clostridium papyrosolvens DSM
           2782]
          Length = 257

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 186/251 (74%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTTA+NLS+ LA  G+ VL+ID+DPQGN ++GLG++  +  +S Y
Sbjct: 2   AKIIAIANQKGGVGKTTTAVNLSSCLAYKGKKVLVIDIDPQGNTTSGLGVDKKNITHSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I ++ I   L++T I NL I PS + L G E+ L     R  RL  AL   +  +F 
Sbjct: 62  DVIINDEPIENTLLKTCIDNLMICPSNIQLAGAEVELVSMISRENRLKSAL-YYIRKEFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+N++ A+D+ILVP+QCE++ALEGLSQL+ TV+ V+R +N  LD++G
Sbjct: 121 FIIIDCPPSLGLLTLNSLTASDTILVPIQCEYYALEGLSQLMNTVKLVQRHLNPQLDVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY T+IPRNVR+SEAPS+G P I+YD K  G++
Sbjct: 181 VVLTMFDARTNLSIQVVEEVKKYFSNKVYRTIIPRNVRLSEAPSFGLPIILYDAKSKGAE 240

Query: 246 AYLKLASELIQ 256
            Y+ LA E+I+
Sbjct: 241 CYIDLAEEVIE 251


>gi|161170272|gb|ABX59242.1| partitioning protein ParA [uncultured marine bacterium EB000_55B11]
 gi|297183801|gb|ADI19924.1| hypothetical protein [uncultured marine bacterium EB000_55B11]
          Length = 261

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/263 (51%), Positives = 188/263 (71%), Gaps = 2/263 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M  K  R+++IANQKGGVGKTTTAIN++ A+A  G  VL++DLDPQGNASTGLGI   DR
Sbjct: 1   MPVKLKRVVSIANQKGGVGKTTTAINMAAAIARNGHKVLVVDLDPQGNASTGLGISPDDR 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           ++++YD+L++  +I + +++T + NLSI+ S  DL   +  L  +K RL RL  +L  + 
Sbjct: 61  EFTAYDVLVDGVDIQKAIVETNVKNLSIVTSNTDLSSADAELMNDKGRLIRLRNSL--EG 118

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F YIF+DCPPS NLLT+NA AA+DS+LVPLQ EF+ALEGLSQL+ TV EVR  + + 
Sbjct: 119 IRHFDYIFIDCPPSLNLLTINAFAASDSVLVPLQSEFYALEGLSQLILTVREVREALGTE 178

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I G++LTMFD R  L+QQV  DVR NL   VY T+IPR VR+SEAPSYG+  +  D  
Sbjct: 179 LFIDGVVLTMFDRRVKLAQQVEIDVRDNLKSLVYKTIIPRTVRLSEAPSYGETILEXDAL 238

Query: 241 CAGSQAYLKLASELIQQERHRKE 263
             G++A + L  E +++++ +++
Sbjct: 239 GRGAEAXIALGDEFLKRDKKKQK 261


>gi|116874150|ref|YP_850931.1| sporulation initiation inhibitor protein SOJ [Listeria welshimeri
           serovar 6b str. SLCC5334]
 gi|116743028|emb|CAK22152.1| sporulation initiation inhibitor protein SOJ [Listeria welshimeri
           serovar 6b str. SLCC5334]
          Length = 253

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 191/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  Y
Sbjct: 2   SKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  I  +L +T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ 
Sbjct: 62  DVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L+I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+NT+IPRNVR+SEAPS+GKP ++YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPRNVRLSEAPSHGKPILLYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVAH 252


>gi|303240063|ref|ZP_07326584.1| Cobyrinic acid ac-diamide synthase [Acetivibrio cellulolyticus CD2]
 gi|302592332|gb|EFL62059.1| Cobyrinic acid ac-diamide synthase [Acetivibrio cellulolyticus CD2]
          Length = 260

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 188/251 (74%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NLS+ L   G+ VLLID+DPQGN+++GLGI     K S+Y
Sbjct: 2   AKVIAVANQKGGVGKTTTAVNLSSCLGYKGKKVLLIDVDPQGNSTSGLGINKKAIKKSAY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI +  I   L++T I NL + PS + L G E+ L     R  RL  +L+  + +++ 
Sbjct: 62  DVLINDVEIKDTLVKTPIDNLMLCPSNIQLAGAEVELVSTISRETRLKNSLN-SIKNEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+N++ A+++ILVP+QCE++ALEGLSQL+ETV+ V++ +N +LD++G
Sbjct: 121 FILIDCPPSLGLLTLNSLTASNTILVPIQCEYYALEGLSQLMETVKLVQKHLNMSLDVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY TVIPRNVR+SEAPSYG P I+YD K  G++
Sbjct: 181 VVLTMFDARTNLSIQVVEEVKKYFRNKVYRTVIPRNVRLSEAPSYGLPIILYDPKSKGAE 240

Query: 246 AYLKLASELIQ 256
            YL LA E+I+
Sbjct: 241 CYLDLADEVIE 251


>gi|332983452|ref|YP_004464893.1| chromosome segregation ATPase [Mahella australiensis 50-1 BON]
 gi|332701130|gb|AEE98071.1| chromosome segregation ATPase [Mahella australiensis 50-1 BON]
          Length = 259

 Score =  273 bits (699), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT +NLS  LA  G+ VL ID+DPQGN ++GLG++    + S Y
Sbjct: 2   SKIIAIANQKGGVGKTTTNVNLSACLAVAGKKVLTIDIDPQGNTTSGLGVDKAKVEKSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI + +I + ++ T + NLSIIPS + L G E+ L     R  RL  A+   +   + 
Sbjct: 62  DVLINDMDITETIVPTNVENLSIIPSNIQLAGAEIELVSVLSREQRLKFAME-PIKQQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AAD +LVP+QCE++ALEGLSQL+ TV+ V++ +N +L+++G
Sbjct: 121 FILVDCPPSLGLLTINALTAADKVLVPIQCEYYALEGLSQLMNTVKLVQKHLNPSLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY T+IPRNVR+ EAPSYG P I+YD KC G++
Sbjct: 181 VVLTMFDARTNLSIQVVDEVKKYFRSKVYRTIIPRNVRLGEAPSYGLPIILYDPKCTGAE 240

Query: 246 AYLKLASELIQ 256
           AY  LA E+I+
Sbjct: 241 AYTDLAEEVIE 251


>gi|163815003|ref|ZP_02206390.1| hypothetical protein COPEUT_01157 [Coprococcus eutactus ATCC 27759]
 gi|158449686|gb|EDP26681.1| hypothetical protein COPEUT_01157 [Coprococcus eutactus ATCC 27759]
          Length = 256

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 185/256 (72%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII IANQKGGVGKTTTAINL+  LAA G+ VL +D+DPQGN ++GLG++    +Y+ Y
Sbjct: 2   GRIIAIANQKGGVGKTTTAINLAACLAAKGKKVLAVDMDPQGNMTSGLGVDRDSLEYTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L  E NI + ++    P L+++P+  +L G E+   G +D    L   +  ++ + F 
Sbjct: 62  DMLRNECNIGECMLINVYPGLNLLPANRELAGAEVEFVGMEDMQHILKTHIR-KVKNKFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+  +LT+NA+ AA+++LVP+QCEFFAL+GLSQL+ T+E +R+ +N  L I+G
Sbjct: 121 YIIIDCPPALGMLTVNALTAANTVLVPIQCEFFALDGLSQLVYTIELIRKNLNRLLTIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFDSR +LS QVV +VR NL   +YNTVIPRNVR++EAPSYG P I YD + AG++
Sbjct: 181 VVFTMFDSRTNLSVQVVENVRDNLNQHIYNTVIPRNVRLAEAPSYGMPIIEYDPRSAGAE 240

Query: 246 AYLKLASELIQQERHR 261
            Y+ LA E+I+ + +R
Sbjct: 241 HYMMLADEVIENDYYR 256


>gi|153854266|ref|ZP_01995565.1| hypothetical protein DORLON_01559 [Dorea longicatena DSM 13814]
 gi|149753041|gb|EDM62972.1| hypothetical protein DORLON_01559 [Dorea longicatena DSM 13814]
          Length = 253

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 187/252 (74%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTTAINLS  LA  G+ VL ID+DPQGN ++GLGI+  + + + YD
Sbjct: 3   RVIAVANQKGGVGKTTTAINLSACLAEKGQKVLAIDMDPQGNMTSGLGIDKDEVEKNIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I +  ++++L + AI NL +IP+++DL   E+ L G  D+ F +  A+   +  D+ Y
Sbjct: 63  LMIGQAGVDEVLQKEAIENLDVIPTSIDLSAAEIELIGVDDKEFIIRNAVQ-PIKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NAM  ADS+LVP+QCE++ALEGLSQL+ TVE V+  +N  L+I+G+
Sbjct: 122 IIIDCPPSLSMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTVELVKERLNPVLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRN+R++EAPSYG P  +YD K  G+ A
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLQQNIYKTIIPRNIRLAEAPSYGMPINLYDPKSTGASA 241

Query: 247 YLKLASELIQQE 258
           Y +LA E++ +E
Sbjct: 242 YQRLADEVMNRE 253


>gi|56965870|ref|YP_177604.1| sporulation initiation inhibitor protein Soj [Bacillus clausii
           KSM-K16]
 gi|56912116|dbj|BAD66644.1| sporulation initiation inhibitor protein Soj [Bacillus clausii
           KSM-K16]
          Length = 253

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 186/250 (74%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT++NL+  LA +G+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   SKIIAIANQKGGVGKTTTSVNLAACLAHLGKRVLLVDIDPQGNATSGVGIEKGDVDECVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE+ +  +++  T + NL +IP+T+ L G E+ L     R  RL KAL+  L S + 
Sbjct: 62  DLLIEDLDARKVVRSTEVNNLDVIPATIQLSGAEIELVPTISREVRLKKALT-PLKSHYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 YIFIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV++T+IPR +R+ EAPSYGKP I+YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFRDKVFDTIIPRTIRLGEAPSYGKPIIVYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E++
Sbjct: 241 VYIDLAKEVV 250


>gi|157803243|ref|YP_001491792.1| soj protein [Rickettsia canadensis str. McKiel]
 gi|157784506|gb|ABV73007.1| soj protein [Rickettsia canadensis str. McKiel]
          Length = 255

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + VL+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAALNKKVLVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI    +   +I T IPNL II S  +L   E+ L   KDR + L K L  ++   ++Y
Sbjct: 62  VLINLIELKDAIIATNIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLK-EIKILYNY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T++ V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIKIVEKKLNPKIKIVGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGALVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YMELTKEILER 251


>gi|16801982|ref|NP_472250.1| partition protein, ParA-like protein [Listeria innocua Clip11262]
 gi|16804828|ref|NP_466313.1| partition protein, ParA-like protein [Listeria monocytogenes EGD-e]
 gi|46908978|ref|YP_015367.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47095598|ref|ZP_00233206.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes str. 1/2a F6854]
 gi|217966005|ref|YP_002351683.1| sporulation initiation inhibitor protein soj [Listeria
           monocytogenes HCC23]
 gi|224498363|ref|ZP_03666712.1| sporulation initiation inhibitor protein soj [Listeria
           monocytogenes Finland 1988]
 gi|224502796|ref|ZP_03671103.1| sporulation initiation inhibitor protein soj [Listeria
           monocytogenes FSL R2-561]
 gi|226225341|ref|YP_002759448.1| Partition protein, ParA homolog [Listeria monocytogenes Clip81459]
 gi|254824843|ref|ZP_05229844.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL J1-194]
 gi|254830772|ref|ZP_05235427.1| hypothetical protein Lmon1_05409 [Listeria monocytogenes 10403S]
 gi|254851905|ref|ZP_05241253.1| partition protein [Listeria monocytogenes FSL R2-503]
 gi|254899751|ref|ZP_05259675.1| hypothetical protein LmonJ_08056 [Listeria monocytogenes J0161]
 gi|254913046|ref|ZP_05263058.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes J2818]
 gi|254930935|ref|ZP_05264294.1| partition protein [Listeria monocytogenes HPB2262]
 gi|254937427|ref|ZP_05269124.1| partition protein [Listeria monocytogenes F6900]
 gi|254993040|ref|ZP_05275230.1| hypothetical protein LmonocytoFSL_08356 [Listeria monocytogenes FSL
           J2-064]
 gi|255025137|ref|ZP_05297123.1| hypothetical protein LmonocytFSL_00350 [Listeria monocytogenes FSL
           J2-003]
 gi|255029512|ref|ZP_05301463.1| hypothetical protein LmonL_11298 [Listeria monocytogenes LO28]
 gi|255520531|ref|ZP_05387768.1| hypothetical protein LmonocFSL_04741 [Listeria monocytogenes FSL
           J1-175]
 gi|284800323|ref|YP_003412188.1| partition protein, ParA-like protein [Listeria monocytogenes
           08-5578]
 gi|284993508|ref|YP_003415276.1| partition protein, ParA-like protein [Listeria monocytogenes
           08-5923]
 gi|289436049|ref|YP_003465921.1| partition protein, ParA family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|290891973|ref|ZP_06554970.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL J2-071]
 gi|300763451|ref|ZP_07073449.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL N1-017]
 gi|16412291|emb|CAD01004.1| Partition protein, ParA homolog [Listeria monocytogenes EGD-e]
 gi|16415464|emb|CAC98148.1| Partition protein, ParA homolog [Listeria innocua Clip11262]
 gi|46882251|gb|AAT05544.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes serotype 4b str. F2365]
 gi|47016028|gb|EAL06953.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes str. 1/2a F6854]
 gi|217335275|gb|ACK41069.1| sporulation initiation inhibitor protein soj [Listeria
           monocytogenes HCC23]
 gi|225877803|emb|CAS06518.1| Partition protein, ParA homolog [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258605201|gb|EEW17809.1| partition protein [Listeria monocytogenes FSL R2-503]
 gi|258610029|gb|EEW22637.1| partition protein [Listeria monocytogenes F6900]
 gi|284055885|gb|ADB66826.1| partition protein, ParA-like protein [Listeria monocytogenes
           08-5578]
 gi|284058975|gb|ADB69914.1| partition protein, ParA-like protein [Listeria monocytogenes
           08-5923]
 gi|289172293|emb|CBH28839.1| partition protein, ParA family [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|290558567|gb|EFD92084.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL J2-071]
 gi|293582482|gb|EFF94514.1| partition protein [Listeria monocytogenes HPB2262]
 gi|293591046|gb|EFF99380.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes J2818]
 gi|293594085|gb|EFG01846.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL J1-194]
 gi|300515728|gb|EFK42777.1| sporulation initiation inhibitor protein SOJ [Listeria
           monocytogenes FSL N1-017]
 gi|307572379|emb|CAR85558.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Listeria
           monocytogenes L99]
 gi|313621910|gb|EFR92575.1| sporulation initiation inhibitor protein Soj [Listeria innocua FSL
           J1-023]
 gi|328468265|gb|EGF39271.1| partition protein, ParA family [Listeria monocytogenes 1816]
 gi|328469132|gb|EGF40080.1| partition protein, ParA family [Listeria monocytogenes 220]
 gi|332313221|gb|EGJ26316.1| Sporulation initiation inhibitor protein soj [Listeria
           monocytogenes str. Scott A]
          Length = 253

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 190/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  Y
Sbjct: 2   SKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  I  +L +T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ 
Sbjct: 62  DVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+NT+IPRNVR+SEAPS+GKP ++YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPRNVRLSEAPSHGKPILLYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVAH 252


>gi|288554597|ref|YP_003426532.1| Soj centromere-like function involved in forespore chromosome
           partition [Bacillus pseudofirmus OF4]
 gi|288545757|gb|ADC49640.1| Soj centromere-like function involved in forespore chromosome
           partition [Bacillus pseudofirmus OF4]
          Length = 253

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/250 (50%), Positives = 187/250 (74%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NLS  LA IG+ VLL+D+DPQGNA++G+G+E  D     Y
Sbjct: 2   AKVIAVANQKGGVGKTTTAVNLSACLAYIGKRVLLVDIDPQGNATSGVGVEKGDVDECVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+     ++ +T++ NL ++PST+ L G E+ L     R  RL +AL   ++ ++ 
Sbjct: 62  DILVEDVEAVSVIKKTSVENLDVLPSTIQLSGAEIELVPTISREVRLKRALQT-VSKNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ A+DS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 YIFIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTELAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV++T+IPRNVR+ EAPS+G+P IIYD K  G+Q
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFREKVFDTIIPRNVRLGEAPSHGQPIIIYDAKSRGAQ 240

Query: 246 AYLKLASELI 255
            Y+ LA E++
Sbjct: 241 VYVDLAKEVV 250


>gi|84501192|ref|ZP_00999397.1| chromosome partitioning protein ParA [Oceanicola batsensis
           HTCC2597]
 gi|84390483|gb|EAQ02971.1| chromosome partitioning protein ParA [Oceanicola batsensis
           HTCC2597]
          Length = 269

 Score =  273 bits (697), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/251 (52%), Positives = 182/251 (72%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ +ANQKGGVGKTTT IN+  ALA  G ++L+IDLDPQGNASTGLGIE+  R+ ++Y+
Sbjct: 11  KIVAVANQKGGVGKTTTTINMGAALAEYGCSILIIDLDPQGNASTGLGIEIEARENTTYE 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTSDF 124
           LL+++  +  +++ T +  LSI+PST+DL   ++ L   + R + L  AL        +F
Sbjct: 71  LLLDDARLEDVILATDVDGLSIVPSTVDLSSADIELIANEKRSYLLHDALRQPAMEKYNF 130

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ +VR++ N  L ++
Sbjct: 131 DYILIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTIRDVRQSANPGLRME 190

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D+RN+LSQQV +D R+NLG  VY T IPRNVR+SEAPSY  P + +D    G+
Sbjct: 191 GVVLTMYDARNNLSQQVEADARENLGEIVYKTRIPRNVRVSEAPSYAMPVLEFDGGSKGA 250

Query: 245 QAYLKLASELI 255
            AY  LA E +
Sbjct: 251 MAYRALAQEFL 261


>gi|157964124|ref|YP_001498948.1| ATPase involved in chromosome partitioning [Rickettsia massiliae
           MTU5]
 gi|157843900|gb|ABV84401.1| ATPase involved in chromosome partitioning [Rickettsia massiliae
           MTU5]
          Length = 255

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 130/251 (51%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLE-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGALVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|34580955|ref|ZP_00142435.1| soj protein [Rickettsia sibirica 246]
 gi|28262340|gb|EAA25844.1| soj protein [Rickettsia sibirica 246]
          Length = 255

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AAI + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAINKKILVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L+ ++   + Y
Sbjct: 62  VLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLA-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|317151728|ref|YP_004119776.1| cobyrinic acid ac-diamide synthase [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316941979|gb|ADU61030.1| cobyrinic acid ac-diamide synthase [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 257

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 184/256 (71%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R I +ANQKGGVGKTTTA+NL+ +LA + + VLL+D DPQGNAS+GLG    D++ + Y
Sbjct: 2   ARRIVVANQKGGVGKTTTAVNLAASLAVMEKRVLLVDFDPQGNASSGLGFYPGDKRENVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L E KNI++ + QT IP L I+P T DL+G E+ L  +  R + L + L   +   + 
Sbjct: 62  SVLFEPKNIHKAICQTDIPFLDILPGTQDLVGAEIELVDKFGREYYL-RELVETVDDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AA  +LVPLQCE++ALEG++QLL T E VR+ +N+ LDI G
Sbjct: 121 YLLIDCPPSLGLLTVNALCAATELLVPLQCEYYALEGIAQLLMTYELVRKRLNTNLDILG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+DSRN LS QV ++VRK     ++ T+IPRNVR+SEAPS+GKP I YD+K  G++
Sbjct: 181 VVLTMYDSRNRLSWQVKNEVRKAFPQHLFETIIPRNVRLSEAPSFGKPVINYDIKSRGAE 240

Query: 246 AYLKLASELIQQERHR 261
           AYL LA E+ +    R
Sbjct: 241 AYLALAQEVAKSSTSR 256


>gi|315305248|ref|ZP_07875205.1| sporulation initiation inhibitor protein Soj [Listeria ivanovii FSL
           F6-596]
 gi|313626381|gb|EFR95557.1| sporulation initiation inhibitor protein Soj [Listeria ivanovii FSL
           F6-596]
          Length = 253

 Score =  272 bits (696), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 189/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  Y
Sbjct: 2   SKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  I  +L  T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ 
Sbjct: 62  DVLVDDVAIQDVLQNTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+NT+IPRNVR+SEAPS+GKP ++YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPRNVRLSEAPSHGKPILLYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVAH 252


>gi|254827359|ref|ZP_05232046.1| partition protein [Listeria monocytogenes FSL N3-165]
 gi|258599737|gb|EEW13062.1| partition protein [Listeria monocytogenes FSL N3-165]
          Length = 253

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 190/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  Y
Sbjct: 2   SKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  I  +L +T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ 
Sbjct: 62  DVLVDDIAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+NT+IPRNVR+SEAPS+GKP ++YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPRNVRLSEAPSHGKPILLYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVAH 252


>gi|83950772|ref|ZP_00959505.1| chromosome partitioning protein ParA [Roseovarius nubinhibens ISM]
 gi|83838671|gb|EAP77967.1| chromosome partitioning protein ParA [Roseovarius nubinhibens ISM]
          Length = 269

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 187/253 (73%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTTAINLS ALA +G+ VLL+DLDPQGNASTGLGIE   R  ++Y
Sbjct: 10  AKIIAVANQKGGVGKTTTAINLSAALAEMGKRVLLVDLDPQGNASTGLGIEADQRDMTTY 69

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--TSD 123
           +LL+EE    + +  T  P L I+P+T DL   ++ L   + R+F L  AL  Q   T +
Sbjct: 70  ELLLEELEAVEAVQPTGTPGLWIVPATTDLSSADIELISNEKRVFLLRDALHQQSLDTLE 129

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             +I +DCPPS NLLT+NA+ AADS+LVPLQ EFFALEGLSQL+ TV EVR T N+ L I
Sbjct: 130 LDFIIIDCPPSLNLLTINALVAADSVLVPLQSEFFALEGLSQLMLTVREVRDTANAKLRI 189

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++LTM+D+RN+LS+QV +D R +LG  VY T+IPRNVR+SEAPS+  P + YD   +G
Sbjct: 190 EGVVLTMYDARNNLSRQVEADARDHLGELVYKTLIPRNVRLSEAPSFAIPVLSYDPASSG 249

Query: 244 SQAYLKLASELIQ 256
           ++AY  LA E+++
Sbjct: 250 ARAYQDLAREMLK 262


>gi|146278697|ref|YP_001168856.1| cobyrinic acid a,c-diamide synthase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556938|gb|ABP71551.1| chromosome segregation ATPase [Rhodobacter sphaeroides ATCC 17025]
          Length = 273

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 181/259 (69%), Gaps = 4/259 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K RI+ IANQKGGVGKTTTAINL+  LA +G  +L++DLDPQGNASTGLGI++  R  +S
Sbjct: 9   KPRIMAIANQKGGVGKTTTAINLAAGLAELGARILVVDLDPQGNASTGLGIDVGSRLKTS 68

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL--SVQLTS 122
           YDLL+++ ++ +++  T +  L I P+  DL   ++ L   + R   L +AL      T 
Sbjct: 69  YDLLLDKPDLAEVIQPTRVETLFICPANADLASADIELAANEKRSQLLREALRQPAMETF 128

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F YI +DCPPS +LLT+NA+ A DS+LVPLQ EFFALEGLSQL+ T+ EVR T N AL 
Sbjct: 129 GFDYILIDCPPSLSLLTVNALIACDSVLVPLQSEFFALEGLSQLMLTIREVRSTANPALK 188

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+G++LTM+D RN+LSQ V  D R+NLG  V+ T+IPRNVR+SEAPSY  P + YD    
Sbjct: 189 IEGVLLTMYDKRNNLSQLVEGDARQNLGDLVFRTMIPRNVRVSEAPSYALPVLAYDPASK 248

Query: 243 GSQAYLKLASELIQQERHR 261
           GS+AY  L  E+    RH+
Sbjct: 249 GSEAYRALTREI--AARHK 265


>gi|15892009|ref|NP_359723.1| soj protein [Rickettsia conorii str. Malish 7]
 gi|157827960|ref|YP_001494202.1| soj protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932648|ref|YP_001649437.1| chromosome partitioning protein [Rickettsia rickettsii str. Iowa]
 gi|238650525|ref|YP_002916377.1| chromosome partitioning protein [Rickettsia peacockii str. Rustic]
 gi|15619124|gb|AAL02624.1| soj protein [Rickettsia conorii str. Malish 7]
 gi|157800441|gb|ABV75694.1| soj protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907735|gb|ABY72031.1| chromosome partitioning protein [Rickettsia rickettsii str. Iowa]
 gi|238624623|gb|ACR47329.1| chromosome partitioning protein [Rickettsia peacockii str. Rustic]
          Length = 255

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 130/251 (51%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L+ ++   + Y
Sbjct: 62  VLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLA-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|158321886|ref|YP_001514393.1| cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs]
 gi|158142085|gb|ABW20397.1| Cobyrinic acid ac-diamide synthase [Alkaliphilus oremlandii OhILAs]
          Length = 257

 Score =  272 bits (695), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 188/253 (74%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT +NLS  +A  G+ V +ID+DPQGN ++GLG++    + + YD
Sbjct: 3   KVIAIFNQKGGVGKTTTNVNLSACIAEKGKKVCVIDIDPQGNTTSGLGVDKNTLENTIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++I E NI + ++ T   NL +IPS++ L G E+ L G K+R  +L KA+  ++ +D+ Y
Sbjct: 63  IIIGETNIKEAILPTEYENLHLIPSSVQLAGAEIELTGMKNREIKLRKAID-EIRADYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS  LLT+N++AA DS+L+P+QCE++ALEG+SQL+ T++ +++ +N +L+IQG+
Sbjct: 122 IFIDCPPSLGLLTINSLAAVDSVLIPIQCEYYALEGVSQLMNTIQLIKKNLNPSLEIQGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +L+MFD R +LS QVV +V+    GKVY T+IPRNVR++EAPS+G+P I YD +  G++A
Sbjct: 182 VLSMFDGRTNLSIQVVDEVKNYFRGKVYTTIIPRNVRLAEAPSFGQPIIYYDARSKGAEA 241

Query: 247 YLKLASELIQQER 259
           Y +LA E +  E 
Sbjct: 242 YTELAEEFLDLEE 254


>gi|220927466|ref|YP_002504375.1| cobyrinic acid ac-diamide synthase [Clostridium cellulolyticum H10]
 gi|219997794|gb|ACL74395.1| Cobyrinic acid ac-diamide synthase [Clostridium cellulolyticum H10]
          Length = 257

 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 186/251 (74%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTTA+NLS+ LA  G+ VL+ID+DPQGN ++GLGI+  + K+S Y
Sbjct: 2   AKIIAIANQKGGVGKTTTAVNLSSCLAYKGKKVLVIDIDPQGNTTSGLGIDKKNIKHSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I ++ I   L++  I  L I PS + L G E+ L     R  RL  AL   +  +F 
Sbjct: 62  DVIINDEPIENTLLEACIDGLMICPSNIQLAGAEVELVSMISRENRLKSAL-YYIRKEFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+N++ A+D+ILVP+QCE++ALEGLSQL+ TV+ V+R +N  L+++G
Sbjct: 121 FIIIDCPPSLGLLTLNSLTASDTILVPIQCEYYALEGLSQLMNTVKLVQRHLNPQLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K  G +VY T+IPRNVR+SEAPS+G P I+YD K  G++
Sbjct: 181 VVLTMFDARTNLSIQVVEEVKKYFGNRVYRTIIPRNVRLSEAPSFGLPIILYDAKSKGAE 240

Query: 246 AYLKLASELIQ 256
            Y+ LA E+I+
Sbjct: 241 CYIDLAEEVIE 251


>gi|157825214|ref|YP_001492934.1| soj protein [Rickettsia akari str. Hartford]
 gi|157799172|gb|ABV74426.1| soj protein [Rickettsia akari str. Hartford]
          Length = 255

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGIRQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL+I+ S  +L   E+ L   KDR + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIISTDIPNLAIVTSNTNLSAAELDLTKLKDREYILMKLLE-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKRLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|229586298|ref|YP_002844799.1| chromosome partitioning ATPase [Rickettsia africae ESF-5]
 gi|228021348|gb|ACP53056.1| ATPase involved in chromosome partitioning [Rickettsia africae
           ESF-5]
          Length = 255

 Score =  271 bits (694), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG G+    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGVSQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L+ ++   + Y
Sbjct: 62  VLTNLIELQDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLA-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|225016770|ref|ZP_03705962.1| hypothetical protein CLOSTMETH_00682 [Clostridium methylpentosum
           DSM 5476]
 gi|224950438|gb|EEG31647.1| hypothetical protein CLOSTMETH_00682 [Clostridium methylpentosum
           DSM 5476]
          Length = 257

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 127/255 (49%), Positives = 184/255 (72%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+IANQKGGVGKTTT +NL+ +L    +  LLID DPQGNAS+G+G+   +   +SYD
Sbjct: 3   KVISIANQKGGVGKTTTTVNLAASLGHNNKKTLLIDTDPQGNASSGMGVNKKEAGQTSYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI      Q++ +T    + IIP+ + L G E+ L   +DR +RL KA++ Q+   + Y
Sbjct: 63  LLIGSATAEQVIRKTKFKQVDIIPAGIQLAGAEIELVELEDRTYRLKKAIA-QVKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  L+T+NA+ A D++LVP+QCE++ALEGLSQL+ TV +V+R  N  ++I+G+
Sbjct: 122 ILIDCPPSLGLITLNALTACDTLLVPIQCEYYALEGLSQLMATVRQVKRMYNPFIEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +L+ QVV++++K    KVY TVIPRNVR+SEAPSYG+P + YD    G++A
Sbjct: 182 LLTMFDGRLNLTMQVVAEIKKFFPKKVYKTVIPRNVRLSEAPSYGEPILYYDKSSKGTKA 241

Query: 247 YLKLASELIQQERHR 261
           YL+L+ ELI+  + R
Sbjct: 242 YLELSKELIKSNKKR 256


>gi|239946971|ref|ZP_04698724.1| chromosome partitioning protein ParA [Rickettsia endosymbiont of
           Ixodes scapularis]
 gi|239921247|gb|EER21271.1| chromosome partitioning protein ParA [Rickettsia endosymbiont of
           Ixodes scapularis]
          Length = 255

 Score =  271 bits (693), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 130/251 (51%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KIIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLE-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E + + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIIEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|226326133|ref|ZP_03801651.1| hypothetical protein COPCOM_03952 [Coprococcus comes ATCC 27758]
 gi|225205675|gb|EEG88029.1| hypothetical protein COPCOM_03952 [Coprococcus comes ATCC 27758]
          Length = 255

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 189/252 (75%), Gaps = 3/252 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINLS+ L+A G+ VL ID+DPQGN S+GLGI+  +  Y+ YD
Sbjct: 3   RIIAVANQKGGVGKTTTAINLSSCLSAKGQKVLAIDMDPQGNMSSGLGIDKDNVAYTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEM-ILGGEKDRLFRLDKALSVQLTSDFS 125
           LLI E  ++Q+L + AI NL +IP+ +DL G E+ +L  E       D+ L ++  S++ 
Sbjct: 63  LLIGEATMDQVLCKEAIENLDVIPANIDLSGAEIELLDTENKEYILRDEVLKIR--SNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS ++LT+N+M  AD++LVP+QCE++ALEGLSQL++T+E V+  +N  L+++G
Sbjct: 121 YVIIDCPPSLSMLTINSMTTADTVLVPIQCEYYALEGLSQLIKTIELVKERLNENLEMEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPS+G P  +YD +  G++
Sbjct: 181 VVFTMYDARTNLSLQVVENVKDNLDQTIYKTIIPRNIRLAEAPSHGLPINLYDPRSTGAE 240

Query: 246 AYLKLASELIQQ 257
           +Y+ LA E+I +
Sbjct: 241 SYMLLADEVIHK 252


>gi|167462787|ref|ZP_02327876.1| Soj [Paenibacillus larvae subsp. larvae BRL-230010]
 gi|322381364|ref|ZP_08055367.1| chromosome partitioning protein; transcriptional regulator-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321154940|gb|EFX47211.1| chromosome partitioning protein; transcriptional regulator-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 257

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D +Y  YD
Sbjct: 3   KIIAITNQKGGVGKTTTSVNLGACLASLGKKVLLVDIDPQGNTTSGIGINKADVEYCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI + +     ++T IPNLSIIP+T+ L G E+ L     R  RL K+L + L  ++ Y
Sbjct: 63  VLINDIHPKDAAVETKIPNLSIIPATIQLAGAEIELVPTISREVRLKKSLQL-LKHNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+N++ AADS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 122 ILIDCPPSLGILTVNSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTTLQIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G+  
Sbjct: 182 LLTMFDARTNLGIQVIEEVKKYFQQKVYQTIIPRNVRLSEAPSHGQSIITYDPRSKGAGV 241

Query: 247 YLKLASELIQQER 259
           YL+LA E+I  E+
Sbjct: 242 YLELAKEVISLEQ 254


>gi|67458509|ref|YP_246133.1| ATPase involved in chromosome partitioning [Rickettsia felis
           URRWXCal2]
 gi|67004042|gb|AAY60968.1| ATPases involved in chromosome partitioning [Rickettsia felis
           URRWXCal2]
          Length = 255

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGV KTTT +NL+TA AA+ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KVIAIVNQKGGVAKTTTTVNLATAFAAVNKKILVIDLDPQGNSSTGFGISQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L  ++   + Y
Sbjct: 62  VLTNLIKLKDAIISTDIPNLEIITSNTNLSAAELDLTKLKDREYILMKLLE-EIKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 VIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAIIYD KC+G+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCSGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|84514915|ref|ZP_01002278.1| chromosome partitioning protein ParA [Loktanella vestfoldensis
           SKA53]
 gi|84511074|gb|EAQ07528.1| chromosome partitioning protein ParA [Loktanella vestfoldensis
           SKA53]
          Length = 265

 Score =  271 bits (693), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 179/262 (68%), Gaps = 2/262 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           + E   +II IANQKGGVGKTTT INL  ALA + + VLLIDLDPQGNASTGLG+    R
Sbjct: 5   IAEAGPKIIAIANQKGGVGKTTTTINLGAALAELKKRVLLIDLDPQGNASTGLGVATDQR 64

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
             ++YD+L  +  + +    T +  L I+P+T DL   +M L   K R F L  AL  Q 
Sbjct: 65  DITTYDVLSGDSTVLEATQPTNVAGLMIVPATTDLSSADMELLDNKKRSFLLRNAL--QS 122

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
            + + YI +DCPPS N+LT+NAM AA SILVPLQ EFFALEGLSQL+ TV +VR++ N  
Sbjct: 123 VTGYDYILIDCPPSLNILTVNAMVAAHSILVPLQSEFFALEGLSQLILTVRDVRQSANPD 182

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I+GI+LTM+D RN+LS QV  D R N+G  V+ TVIPRNVR+SEAPS+  P + YD  
Sbjct: 183 LRIEGIVLTMYDGRNNLSLQVEQDARDNMGDMVFKTVIPRNVRLSEAPSFAMPVLTYDSS 242

Query: 241 CAGSQAYLKLASELIQQERHRK 262
             GS AY  LA E+I++ + ++
Sbjct: 243 SKGSIAYRALAREVIKKSKKQR 264


>gi|315284158|ref|ZP_07872076.1| sporulation initiation inhibitor protein Soj [Listeria marthii FSL
           S4-120]
 gi|313612198|gb|EFR86422.1| sporulation initiation inhibitor protein Soj [Listeria marthii FSL
           S4-120]
          Length = 253

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 190/252 (75%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  Y
Sbjct: 2   SKVIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  I  +L +T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ 
Sbjct: 62  DVLVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV++T+IPRNVR+SEAPS+GKP ++YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFSTIIPRNVRLSEAPSHGKPILLYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVAH 252


>gi|89074719|ref|ZP_01161177.1| Putative ParA family protein [Photobacterium sp. SKA34]
 gi|89049483|gb|EAR55044.1| Putative ParA family protein [Photobacterium sp. SKA34]
          Length = 265

 Score =  271 bits (692), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT +NL+ +LAA    VL++DLDPQGNA+   G++ Y    ++YD
Sbjct: 3   RIIAVANQKGGVGKTTTCVNLAASLAATQRKVLVVDLDPQGNATMASGVDKYQVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   N ++I+    +  +I +  D+   E+ L     R  RL  AL+ ++  D+ Y
Sbjct: 63  LLVEETPFNDVVIKETTGDYHLIAANGDVTAAEIKLMEVFAREVRLRTALA-KVRDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAM AADS+LVP+QCE+FALEGL+ L++T+ ++   VNS L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNSELKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+G+PA+ YD   +G++A
Sbjct: 182 LRTMFDPRNRLANEVSQQLKKHFGDKVYRTVIPRNVRLAEAPSHGRPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E+I+++
Sbjct: 242 YLALAGEMIRRD 253


>gi|58039524|ref|YP_191488.1| chromosome partitioning protein ParA [Gluconobacter oxydans 621H]
 gi|58001938|gb|AAW60832.1| Chromosome partitioning protein ParA [Gluconobacter oxydans 621H]
          Length = 267

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 183/263 (69%), Gaps = 1/263 (0%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E   +RII + NQKGGVGKTTT INL+  LA  G+ VLL+DLDPQGNASTGLGI+   R 
Sbjct: 6   ESPTTRIIAVTNQKGGVGKTTTTINLAAGLARQGQRVLLVDLDPQGNASTGLGIDYDQRN 65

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
             +Y  L+ E   + +   T   NL+II +  +L G E+ + G++ R +RL  AL   L 
Sbjct: 66  TGTYAALMVEAEPHALPQPTGFDNLAIITANNELAGAELEMIGDERREYRLRDALRA-LE 124

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D+  I +DCPPS  LLT+NA+ A+DS++VPLQCEFFALEG+SQL+ T++ VRR  N+ L
Sbjct: 125 GDYDTILIDCPPSLGLLTLNALVASDSVIVPLQCEFFALEGISQLVRTIDRVRRAFNADL 184

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            ++GI+LTM+D RN+LS+ V  D R   G +V+ T+IPRN+RISEA S+G P + YD + 
Sbjct: 185 HLEGIVLTMYDRRNNLSELVAQDARGFFGDQVFETLIPRNIRISEAQSHGSPVLDYDARS 244

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
            G+ AYL LA ELI++ +++ +A
Sbjct: 245 TGAIAYLALADELIKRNKNKAKA 267


>gi|323699677|ref|ZP_08111589.1| cobyrinic acid ac-diamide synthase [Desulfovibrio sp. ND132]
 gi|323459609|gb|EGB15474.1| cobyrinic acid ac-diamide synthase [Desulfovibrio desulfuricans
           ND132]
          Length = 252

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 11  IANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIE 70
           IANQKGGVGKTTTAINL+ +LA + + VLL+D DPQGNAS+GLG    D++ + Y +L E
Sbjct: 2   IANQKGGVGKTTTAINLAASLAVMEKRVLLVDCDPQGNASSGLGFYPGDKRENIYTVLFE 61

Query: 71  EKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLD 130
            KNI + ++ T IP L I+P T DL+G E+ L  +  R F L + L  Q   ++ +I +D
Sbjct: 62  PKNIGKAILPTGIPYLDILPGTQDLVGAEIELVDKFGREFYL-RELIDQADPEYDFILID 120

Query: 131 CPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTM 190
           CPPS  LLT+NA+ AAD +LVPLQCE++ALEG++QLL T E VR+ +N  LDI G++LTM
Sbjct: 121 CPPSLGLLTVNALCAADELLVPLQCEYYALEGIAQLLMTYELVRKRLNPGLDILGVVLTM 180

Query: 191 FDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKL 250
           +DSRN LS QV ++VRK     ++ T+IPRNVR+SEAPS+GKP I YD+K  G++AYL L
Sbjct: 181 YDSRNRLSWQVKNEVRKAFPQHLFETIIPRNVRLSEAPSFGKPVINYDIKSRGAEAYLAL 240

Query: 251 ASEL 254
           A E+
Sbjct: 241 AQEV 244


>gi|225181155|ref|ZP_03734601.1| Cobyrinic acid ac-diamide synthase [Dethiobacter alkaliphilus AHT
           1]
 gi|225168124|gb|EEG76929.1| Cobyrinic acid ac-diamide synthase [Dethiobacter alkaliphilus AHT
           1]
          Length = 258

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/254 (50%), Positives = 185/254 (72%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SR+I +ANQKGGVGKTTT++NLS  LAA G +VLL+D+DPQGNA++G+G E  + K   Y
Sbjct: 2   SRVIAVANQKGGVGKTTTSVNLSACLAAQGRSVLLLDIDPQGNATSGIGQEKKNIKVCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI E  +  I+I++ I NL ++P+T+ L G E+ L     R  RL + L  ++   + 
Sbjct: 62  DALINELPLKNIIIKSVIKNLDLVPATIQLAGAEIELVPTMSREVRLRRVLE-EVRDLYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AAD++LVP+QCE++ALEGLSQL  TV+ V++ +N+ L  +G
Sbjct: 121 YIIIDCPPSLGLLTINALTAADTVLVPIQCEYYALEGLSQLTNTVKLVQKHLNTELRYEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +L+ QV  +V    G KV+ TVIPRNVR+SEAPS+G+P I+YD +  G++
Sbjct: 181 VVLTMFDSRTNLANQVADEVHNYFGNKVFKTVIPRNVRLSEAPSHGQPIIVYDERSKGAE 240

Query: 246 AYLKLASELIQQER 259
            Y++LA E++  E+
Sbjct: 241 TYIELAKEVMANEQ 254


>gi|225570315|ref|ZP_03779340.1| hypothetical protein CLOHYLEM_06412 [Clostridium hylemonae DSM
           15053]
 gi|225160847|gb|EEG73466.1| hypothetical protein CLOHYLEM_06412 [Clostridium hylemonae DSM
           15053]
          Length = 256

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 191/255 (74%), Gaps = 1/255 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  R+I IANQKGGVGKTTTAINLS  LA  G+ VL +D+DPQGN ++GLG++    + +
Sbjct: 3   KMGRVIAIANQKGGVGKTTTAINLSACLAEKGQKVLAVDMDPQGNMTSGLGLDKETVEKT 62

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            YDL+I E ++ ++L + A+ NL I+P+++DL   E+ L G +++ F + +A+   +  +
Sbjct: 63  IYDLIIGEADVEEVLQKEALENLDILPTSIDLSAAEIELIGVEEKEFIVREAIK-DIRDN 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           +++I +DCPPS ++LT+NAM  AD++LVP+QCE++ALEGLSQL+ TVE V+  +N  L+I
Sbjct: 122 YNFIIIDCPPSLSMLTINAMTTADTVLVPIQCEYYALEGLSQLIHTVELVKERLNPGLEI 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++ TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P   YD K AG
Sbjct: 182 EGVVFTMYDARTNLSLQVVENVKDNLQQAIYKTIIPRNIRLAEAPSYGMPISQYDPKSAG 241

Query: 244 SQAYLKLASELIQQE 258
           S++Y+KLA E++ ++
Sbjct: 242 SESYMKLAEEVMNKK 256


>gi|51473285|ref|YP_067042.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia
           typhi str. Wilmington]
 gi|51459597|gb|AAU03560.1| chromosome partitioning protein ParA (Soj protein) [Rickettsia
           typhi str. Wilmington]
          Length = 255

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 183/257 (71%), Gaps = 3/257 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGV KTTT +NL+TA A++ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KIIAIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSSTGFGIIQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   KDR + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIISTNIPNLEIITSNTNLSAAELDLTTLKDREYILMKLLE-EVKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSNLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAI+YD KCAG+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAILYDYKCAGAMA 240

Query: 247 YLKLASELIQQERHRKE 263
           Y++L  E++  ER+ K+
Sbjct: 241 YIELTKEIL--ERYGKK 255


>gi|160882053|ref|YP_001561021.1| cobyrinic acid ac-diamide synthase [Clostridium phytofermentans
           ISDg]
 gi|160430719|gb|ABX44282.1| Cobyrinic acid ac-diamide synthase [Clostridium phytofermentans
           ISDg]
          Length = 284

 Score =  270 bits (690), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 185/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I +ANQKGGVGKTTTAINL+  LA  G  VL ID+DPQGN ++GLGI     + + Y+
Sbjct: 3   KTIAVANQKGGVGKTTTAINLAACLAEKGMKVLTIDIDPQGNTTSGLGINKASLENTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I E N+ + +  + +PNL +IPS ++L G E+ L G +D+ + L K ++  +   F Y
Sbjct: 63  LMIGESNVEKCIHDSIVPNLVVIPSDVNLAGAEIELIGIEDKEYILKKHIN-PIKDFFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N LT+NAM  ADS+LVP+QCE++ALEGL+QL+ T+  V++ +N++L+I+G+
Sbjct: 122 IIIDCPPSLNTLTINAMTTADSVLVPIQCEYYALEGLTQLIHTINLVKKRLNASLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +VR NL   +YN++IPRNVR++EAPS+G P  IYD K AG+ A
Sbjct: 182 VFTMYDARTNLSLQVVENVRSNLEQNIYNSIIPRNVRLAEAPSHGLPISIYDPKSAGADA 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I+Q+
Sbjct: 242 YRDLADEVIKQD 253


>gi|257413829|ref|ZP_04744355.2| sporulation initiation inhibitor protein Soj [Roseburia
           intestinalis L1-82]
 gi|257202170|gb|EEV00455.1| sporulation initiation inhibitor protein Soj [Roseburia
           intestinalis L1-82]
          Length = 266

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 189/253 (74%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRII IANQKGGVGKTTTAINL++ LA  G+ VL IDLDPQGN ++GLG+   + + + Y
Sbjct: 13  SRIIAIANQKGGVGKTTTAINLASCLAEAGKKVLTIDLDPQGNMTSGLGVNKNELENTVY 72

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L+++E +I + ++ T +  + IIPS ++L G E+ L G +D+ + L  A+   +  D+ 
Sbjct: 73  ELMLDECSIKESMVDTVVDGMKIIPSNVNLAGAEIELLGIEDKEYILKNAVD-YVRDDYD 131

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS N+LT+NAM  ADS+LVP+QCE++ALEGLSQL+ T++ V++ +N  L I G
Sbjct: 132 FIIIDCPPSLNMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTIDLVQQRLNPELHIDG 191

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D R +LS QVV +VR NL  K+Y+T+IPRN+R++EAPS+G P  +YD K AG++
Sbjct: 192 IVFTMYDVRTNLSNQVVENVRTNLDTKIYDTLIPRNIRLAEAPSHGLPINMYDTKSAGAE 251

Query: 246 AYLKLASELIQQE 258
           +Y  LA E+++++
Sbjct: 252 SYRMLAKEVMERK 264


>gi|226225434|ref|YP_002759540.1| chromosome partitioning protein ParA [Gemmatimonas aurantiaca T-27]
 gi|226088625|dbj|BAH37070.1| chromosome partitioning protein ParA [Gemmatimonas aurantiaca T-27]
          Length = 259

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 187/253 (73%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ IANQKGGVGKTTTA+NL+ +LA   +  LLID DPQGNA++G GI   D   ++YD
Sbjct: 3   RILAIANQKGGVGKTTTAVNLAASLAVAEQRTLLIDADPQGNATSGCGISREDFTLNTYD 62

Query: 67  LLIEEKNINQILIQ-TAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L+ E +++Q L++     +L ++P+T DL  +E+ L    DR+ R+  AL+  +   + 
Sbjct: 63  VLLGEASVDQALVRGVQFRHLDVLPTTPDLAAVEVELVDADDRISRMHDALA-PIRDRYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  L+T+N + AAD++L+PLQCE++ALEGLSQLL TV+ V+ + NS LD++ 
Sbjct: 122 FILIDCPPSLGLITLNMLVAADALLIPLQCEYYALEGLSQLLSTVQRVQDSANSTLDVEA 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +LS+QV +D R + G KV+ TVIPRN+R++EAPS+GKP ++YD+   G+Q
Sbjct: 182 VLLTMYDARLNLSRQVAADARAHFGDKVFQTVIPRNIRLAEAPSFGKPIVVYDIASVGAQ 241

Query: 246 AYLKLASELIQQE 258
           AY+ +A E+I ++
Sbjct: 242 AYMAVAREMIDRK 254


>gi|299820860|ref|ZP_07052749.1| sporulation initiation inhibitor protein Soj [Listeria grayi DSM
           20601]
 gi|299817881|gb|EFI85116.1| sporulation initiation inhibitor protein Soj [Listeria grayi DSM
           20601]
          Length = 253

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 188/252 (74%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + +   Y
Sbjct: 2   SKIIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEVENCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+++  +  +L+ T + NL +IP+T+ L G E+ L     R  RL KA++  +  ++ 
Sbjct: 62  NVLVDDVELKDVLLHTELDNLDVIPATIQLAGAEVELVPAISREIRLKKAINT-VKDNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL TV  V++ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTVRIVQKHLNEDLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+ T+IPRNVR+SEAPS+GKP I+YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQNKVFQTIIPRNVRLSEAPSHGKPIILYDAKSKGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E+I  
Sbjct: 241 VYLELAKEVIAH 252


>gi|42525226|ref|NP_970606.1| partition protein, ParA-like protein [Bdellovibrio bacteriovorus
           HD100]
 gi|39577437|emb|CAE81260.1| Partition protein, ParA homolog [Bdellovibrio bacteriovorus HD100]
          Length = 286

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/253 (51%), Positives = 188/253 (74%), Gaps = 2/253 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK-Y 62
           K ++ I IANQKGGVGKTTT++NLS+ALA++G+ VLLID+DPQGNAS+GLGI+ Y+ +  
Sbjct: 16  KMAKTICIANQKGGVGKTTTSVNLSSALASLGKRVLLIDMDPQGNASSGLGIKRYESQDA 75

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
           +SY +LI EK + +   +T+ PNL +  +  DL+G E+ L     R +RL +A++  +  
Sbjct: 76  NSYHVLIGEKTLTEATQKTSNPNLQVSTANPDLVGAEIELVDMPQREYRLKQAIAT-VAD 134

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + ++ +DCPPS  LLT+N++ AADS LVPLQCE++ALEGLSQLL T   +++ +N  L 
Sbjct: 135 QYDFVIIDCPPSLGLLTLNSLNAADSFLVPLQCEYYALEGLSQLLNTAGLIKKNLNPQLH 194

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+LTMFD RN+LS QVV++++ + G KV+N +IPRNVR+SEAPS+G+    YD K  
Sbjct: 195 IEGIVLTMFDIRNNLSHQVVTEIKNHFGEKVFNAIIPRNVRLSEAPSHGQSIFEYDSKSI 254

Query: 243 GSQAYLKLASELI 255
           G+  YL+LA E+I
Sbjct: 255 GAVRYLELAREVI 267


>gi|160932441|ref|ZP_02079831.1| hypothetical protein CLOLEP_01276 [Clostridium leptum DSM 753]
 gi|156868400|gb|EDO61772.1| hypothetical protein CLOLEP_01276 [Clostridium leptum DSM 753]
          Length = 254

 Score =  270 bits (689), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTTA+NLS A+   G   LL+D+DPQGNAS+G+GI+      S+Y+
Sbjct: 3   KIIAVANQKGGVGKTTTAVNLSAAMGERGHKTLLVDIDPQGNASSGVGIDRRSVPKSTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI E    + L+QT  PNL+I+PS+++L G E+ L     R  RL  AL+  L  ++ Y
Sbjct: 63  LLIGEAGAKEALVQTQFPNLTILPSSLNLAGAELELVDFDHREARLKTALA-PLREEYEY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           +F+DCPPS  ++T NA+ AAD++LVP+QCE++ALEGLSQL+ +V  V+R  N  L+I+G+
Sbjct: 122 LFIDCPPSLGMITTNALCAADTLLVPIQCEYYALEGLSQLMNSVRRVKRQYNERLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D R +L+QQVV +V+K    KV+ +VIPR+VR+SEAPSYG P + +D    G++A
Sbjct: 182 LLTMYDGRLNLTQQVVEEVKKYFPRKVFRSVIPRSVRLSEAPSYGVPIMYFDKSNRGTEA 241

Query: 247 YLKLASELIQQER 259
           Y  LA EL +  R
Sbjct: 242 YRSLAEELEKNNR 254


>gi|94266826|ref|ZP_01290488.1| Cobyrinic acid a,c-diamide synthase [delta proteobacterium MLMS-1]
 gi|93452501|gb|EAT03095.1| Cobyrinic acid a,c-diamide synthase [delta proteobacterium MLMS-1]
          Length = 284

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 189/266 (71%), Gaps = 7/266 (2%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           + + +R++ +ANQKGGVGK+TTAINL+ +LA +G  VL++D DPQGN S+GLG +  D +
Sbjct: 7   QHRAARVVALANQKGGVGKSTTAINLAASLAVLGRRVLVVDADPQGNTSSGLGWQALDDQ 66

Query: 62  YSS----YDLLIEEKNINQILIQTAIPN--LSIIPSTMDLLGIEMILGGEKDRLFRLDKA 115
                  Y  L+ +  I Q ++  A  N  L ++PS +DL+G+E+ L G +DR   L + 
Sbjct: 67  NQERPHLYHCLLADTTIEQAVMAVAEMNDKLFLLPSRIDLIGVEVELMGSEDREGYLRRM 126

Query: 116 LSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRR 175
           L+  +  D+ +IF+DCPPS  LLT+NA+ AADS++VP+QCE+FALEGLSQL+ T+  V+ 
Sbjct: 127 LA-PVRGDYDFIFIDCPPSLGLLTINALTAADSVVVPMQCEYFALEGLSQLVRTISLVKN 185

Query: 176 TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAI 235
           + N  L I+G++LTMFD RN L+ QV  +V  +  GK Y TVIPRNVR+SEAPS+GKPAI
Sbjct: 186 SYNQPLIIEGLLLTMFDGRNKLTHQVAGEVENHFPGKSYQTVIPRNVRLSEAPSHGKPAI 245

Query: 236 IYDLKCAGSQAYLKLASELIQQERHR 261
           +YD + +G+ +Y++LA E +++ + R
Sbjct: 246 LYDRRSSGAVSYVQLAREFLRRHKQR 271


>gi|51894467|ref|YP_077158.1| ParA family ATPase [Symbiobacterium thermophilum IAM 14863]
 gi|51858156|dbj|BAD42314.1| ParA, ParA family ATPase [Symbiobacterium thermophilum IAM 14863]
          Length = 258

 Score =  269 bits (688), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/256 (49%), Positives = 188/256 (73%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SR+I IANQKGGVGKTTTA+NLS  LA +G+ VLLID+DPQGNA++GLG++    K S Y
Sbjct: 2   SRVIAIANQKGGVGKTTTAVNLSACLADLGKRVLLIDVDPQGNATSGLGLDRRRLKASVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L++E  + + ++ T +  L ++P+T+DL G E+ L     R  RL +AL   +   + 
Sbjct: 62  DVLLDELPLQEAVVNTRVRGLQVVPATIDLAGAEIELVPRIARESRLKQALD-PVRDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPPS  LLT+NA+ AADSIL+P+QCE++ALEGL+QL++T   VR  +N  L+++G
Sbjct: 121 FVLMDCPPSLGLLTINALTAADSILIPIQCEYYALEGLTQLMDTFRLVREALNPNLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QVV +V++   G+VY ++I RNVR+SEAPS+G P  +YD +  G++
Sbjct: 181 VVLTMFDGRTNLSIQVVEEVKRFFKGQVYRSIITRNVRLSEAPSHGLPITLYDPRSKGAE 240

Query: 246 AYLKLASELIQQERHR 261
           AY++LA E+I++   R
Sbjct: 241 AYMELAREVIERVEER 256


>gi|89100942|ref|ZP_01173789.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. NRRL B-14911]
 gi|89084351|gb|EAR63505.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. NRRL B-14911]
          Length = 253

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGACLAYIGKKVLLVDIDPQGNATSGIGIEKADVDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++    +++  TA+ NL  IP+T+ L G E+ L     R  RL +AL  ++  DF 
Sbjct: 62  DVLVDDVEALKVIKPTAVENLYAIPATIQLAGAEIELVPTISREVRLKRALE-EVKKDFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ A+D++L+P+QCE++ALEGLSQLL TV  V++ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTINSLTASDAVLIPVQCEYYALEGLSQLLNTVRLVQKHLNHDLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+P IIYD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQDKVYKTIIPRNVRLSEAPSHGEPIIIYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            YL LA E+I
Sbjct: 241 VYLDLAKEVI 250


>gi|255261695|ref|ZP_05341037.1| chromosome partitioning protein ParA [Thalassiobium sp. R2A62]
 gi|255104030|gb|EET46704.1| chromosome partitioning protein ParA [Thalassiobium sp. R2A62]
          Length = 273

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 138/257 (53%), Positives = 176/257 (68%), Gaps = 2/257 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  RII +ANQKGGVGKTTT INL  +LA +G   LL+DLDPQGNASTGLGI    R+ +
Sbjct: 8   KPCRIIAVANQKGGVGKTTTTINLGASLAKLGYRTLLVDLDPQGNASTGLGISPASREVT 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           +Y+ L+ +      +  T + NL I+P+T DL   ++ L   + R F L  AL   L  D
Sbjct: 68  TYEFLLGDARPMDAIQPTDVDNLEIVPATTDLSSADIELMNNEKRSFLLFDALRQPLLDD 127

Query: 124 FS--YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           F   YI +DCPPS NLLT+NAM A+DS+LVPLQ EFFALEGLSQL+ T+ +VR+  N  L
Sbjct: 128 FGFDYILIDCPPSLNLLTVNAMVASDSVLVPLQSEFFALEGLSQLMLTIRDVRQVANPKL 187

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++LTM+D+RN+LSQQV  D R NL   V+ TVIPRNVR+SEAPS+  P I Y+   
Sbjct: 188 RIEGVVLTMYDARNNLSQQVEQDARDNLQDLVFKTVIPRNVRVSEAPSFAMPVIEYEPTS 247

Query: 242 AGSQAYLKLASELIQQE 258
            GS AY  LA EL+ ++
Sbjct: 248 KGSIAYRALAKELVSRQ 264


>gi|328555781|gb|AEB26273.1| Chromosome partitioning protein parA [Bacillus amyloliquefaciens
           TA208]
 gi|328914170|gb|AEB65766.1| Chromosome partitioning protein parA [Bacillus amyloliquefaciens
           LL3]
          Length = 253

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 184/248 (74%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++GLGIE  D  +  YD
Sbjct: 3   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVDHCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++ +I+  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ Y
Sbjct: 63  ILVDDADVTEIIKPTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 122 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFRDKVYQTIIPRNVRLSEAPSHGKPIILYDPRSRGAEV 241

Query: 247 YLKLASEL 254
           YL LA E+
Sbjct: 242 YLDLAKEV 249


>gi|295697828|ref|YP_003591066.1| Cobyrinic acid ac-diamide synthase [Bacillus tusciae DSM 2912]
 gi|295413430|gb|ADG07922.1| Cobyrinic acid ac-diamide synthase [Bacillus tusciae DSM 2912]
          Length = 255

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I + NQKGGVGKTTT++NL  ALA++G  VLLID+DPQGN ++G+GI   D K+  Y
Sbjct: 2   ARVIAVTNQKGGVGKTTTSVNLGAALASLGRRVLLIDIDPQGNTTSGIGINKADVKHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I + +    ++ T   NLSIIP+T+ L G E+ L     R  RL +A+   L   F 
Sbjct: 62  DVVINDVSAVDAILPTRTENLSIIPATIQLAGAEIELVPIMSREVRLRRAIQ-SLRGSFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +NS L ++G
Sbjct: 121 YILIDCPPSLGLLTVNALTAADSVLIPIQCEYYALEGLSQLLNTIRLVQKHLNSRLQVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QVV DV+K    KVY T+IPRNVR+SEAPS+G P I YD +  G++
Sbjct: 181 VLLTMFDARTNLGVQVVEDVKKYFREKVYKTIIPRNVRLSEAPSHGMPVIEYDPRSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y+ LA E++  
Sbjct: 241 VYMDLAREVVSH 252


>gi|94264822|ref|ZP_01288598.1| Cobyrinic acid a,c-diamide synthase [delta proteobacterium MLMS-1]
 gi|93454703|gb|EAT04964.1| Cobyrinic acid a,c-diamide synthase [delta proteobacterium MLMS-1]
          Length = 284

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 189/266 (71%), Gaps = 7/266 (2%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           + + +R++ +ANQKGGVGK+TTAINL+ +LA +G  VL++D DPQGN S+GLG +  D +
Sbjct: 7   QHRAARVVALANQKGGVGKSTTAINLAASLAVLGRRVLVVDADPQGNTSSGLGWQALDDQ 66

Query: 62  YSS----YDLLIEEKNINQILIQTAIPN--LSIIPSTMDLLGIEMILGGEKDRLFRLDKA 115
                  Y  L+ +  I Q ++  A  N  L ++PS +DL+G+E+ L G +DR   L + 
Sbjct: 67  NQERPHLYHCLLADTTIEQAVMAVAEMNEKLFLLPSRIDLIGVEVELMGSEDRDGYLRRM 126

Query: 116 LSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRR 175
           L+  +  D+ +IF+DCPPS  LLT+NA+ AADS++VP+QCE+FALEGLSQL+ T+  V+ 
Sbjct: 127 LA-PVRGDYDFIFIDCPPSLGLLTINALTAADSVVVPMQCEYFALEGLSQLVRTISLVKN 185

Query: 176 TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAI 235
           + N  L I+G++LTMFD RN L+ QV  +V  +  GK Y TVIPRNVR+SEAPS+GKPAI
Sbjct: 186 SYNQPLIIEGLLLTMFDGRNKLTHQVAGEVENHFPGKSYQTVIPRNVRLSEAPSHGKPAI 245

Query: 236 IYDLKCAGSQAYLKLASELIQQERHR 261
           +YD + +G+ +Y++LA E +++ + R
Sbjct: 246 LYDRRSSGAVSYVQLAREFLRRHKQR 271


>gi|27364445|ref|NP_759973.1| ParA family protein [Vibrio vulnificus CMCP6]
 gi|37681444|ref|NP_936053.1| ParA family protein [Vibrio vulnificus YJ016]
 gi|320154849|ref|YP_004187228.1| chromosome (plasmid) partitioning protein ParA/Sporulation
           initiation inhibitor protein Soj [Vibrio vulnificus
           MO6-24/O]
 gi|27360564|gb|AAO09500.1| ParA family protein [Vibrio vulnificus CMCP6]
 gi|37200196|dbj|BAC96024.1| ParA family protein [Vibrio vulnificus YJ016]
 gi|319930161|gb|ADV85025.1| chromosome (plasmid) partitioning protein ParA / Sporulation
           initiation inhibitor protein Soj [Vibrio vulnificus
           MO6-24/O]
          Length = 257

 Score =  269 bits (688), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT +NL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCVNLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   +Q++ +T      +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEETPFDQVVCKTTTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNDKLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AGS+A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKHSAGSKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|308175805|ref|YP_003922510.1| Chromosome partitioning protein parA [Bacillus amyloliquefaciens
           DSM 7]
 gi|307608669|emb|CBI45040.1| Chromosome partitioning protein parA [Bacillus amyloliquefaciens
           DSM 7]
          Length = 259

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 184/248 (74%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++GLGIE  D  +  YD
Sbjct: 9   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVDHCVYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++ +I+  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ Y
Sbjct: 69  ILVDDADVTEIIKPTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDY 127

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 128 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGV 187

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 188 LLTMLDARTNLGIQVIEEVKKYFRDKVYQTIIPRNVRLSEAPSHGKPIILYDPRSRGAEV 247

Query: 247 YLKLASEL 254
           YL LA E+
Sbjct: 248 YLDLAKEV 255


>gi|126651986|ref|ZP_01724178.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. B14905]
 gi|169830193|ref|YP_001700351.1| sporulation initiation inhibitor protein soj [Lysinibacillus
           sphaericus C3-41]
 gi|126591255|gb|EAZ85364.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. B14905]
 gi|168994681|gb|ACA42221.1| Sporulation initiation inhibitor protein soj [Lysinibacillus
           sphaericus C3-41]
          Length = 253

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 183/250 (73%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT++NLS  LA +G+ VLLID DPQGN ++GLGI   D +   YD
Sbjct: 3   RIIAIANQKGGVGKTTTSVNLSACLAYLGKKVLLIDTDPQGNTTSGLGINKGDIQSCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+++++  ++ +T + NLSI+P+T+ L G E+ L     R  RL  AL   +  DF Y
Sbjct: 63  VLIDDEDVENVIQKTNVDNLSIVPATISLAGAEIELVSTISREVRLKHALQ-NVKEDFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G+
Sbjct: 122 IIIDCPPSLGLLTINALTASDALIIPVQCEYYALEGLSQLLSTVRLVQKHLNQQLYIDGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+P I YD +  G++ 
Sbjct: 182 LLTMLDARTNLGLQVIDEVKKYFQDKVYKTIIPRNVRLSEAPSHGQPIITYDARSRGAEV 241

Query: 247 YLKLASELIQ 256
           YL++A E+I+
Sbjct: 242 YLEMAREVIK 251


>gi|282848777|ref|ZP_06258172.1| sporulation initiation inhibitor protein Soj [Veillonella parvula
           ATCC 17745]
 gi|282581563|gb|EFB86951.1| sporulation initiation inhibitor protein Soj [Veillonella parvula
           ATCC 17745]
          Length = 256

 Score =  269 bits (687), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 182/255 (71%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLLIDLDPQGNAS+GLGIE  D K   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKTVLLIDLDPQGNASSGLGIEKDDLKLCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ + I  I+  T + NL + P+T+ L G E+ L     R   L KAL+  +   + +
Sbjct: 63  VLIDGEPIADIVQPTMLENLFVAPATIQLAGAEVELVSVVSRETMLKKALA-SVRDKYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G+
Sbjct: 122 IVIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSIQVADEVKKFFGNKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGADV 241

Query: 247 YLKLASELIQQERHR 261
           Y KLA E+I+  + +
Sbjct: 242 YTKLAKEVIKASKAK 256


>gi|160941475|ref|ZP_02088810.1| hypothetical protein CLOBOL_06366 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435621|gb|EDP13388.1| hypothetical protein CLOBOL_06366 [Clostridium bolteae ATCC
           BAA-613]
          Length = 256

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 188/251 (74%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RIITIANQKGGVGKTTTAINLS  LA  G++V+L+D DPQGNAS+GLG+E  D   + YD
Sbjct: 3   RIITIANQKGGVGKTTTAINLSACLAEAGQHVMLVDFDPQGNASSGLGLEQEDFDKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++IEE ++N+ +I+   PNL ++PS M+L G E+     +D+   L   L+ Q+   + +
Sbjct: 63  MMIEEASVNECIIKEIQPNLDVLPSDMNLAGAEIEFQEVEDKEKLLSSCLN-QVRDTYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NA+ AAD++LVP+QCE++ALEGL+Q+L+TV+ V+R +N  L+++G+
Sbjct: 122 IIIDCPPSLNILTINALTAADTVLVPIQCEYYALEGLNQVLKTVDLVKRKLNPELELEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV  V+ +L   +Y T+IPRNVR++EAPS+G    +YD +  G+++
Sbjct: 182 VFTMYDARTNLSLEVVESVKSSLNRTIYKTIIPRNVRLAEAPSHGMSINLYDSRSTGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA+E++ +
Sbjct: 242 YRMLAAEVMSR 252


>gi|291537000|emb|CBL10112.1| ATPases involved in chromosome partitioning [Roseburia intestinalis
           M50/1]
          Length = 255

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 189/253 (74%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRII IANQKGGVGKTTTAIN+++ LA  G+ VL IDLDPQGN ++GLG+   + + + Y
Sbjct: 2   SRIIAIANQKGGVGKTTTAINIASCLAEAGKKVLTIDLDPQGNMTSGLGVNKNELENTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L+++E +I + ++ T +  + IIPS ++L G E+ L G +D+ + L  A+   +  D+ 
Sbjct: 62  ELMLDECSIKESMVDTVVDGMKIIPSNVNLAGAEIELLGIEDKEYILKNAVD-YVRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS N+LT+NAM  ADS+LVP+QCE++ALEGLSQL+ T++ V++ +N  L I G
Sbjct: 121 FIIIDCPPSLNMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTIDLVQQRLNPELHIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D R +LS QVV +VR NL  K+Y+T+IPRN+R++EAPS+G P  +YD K AG++
Sbjct: 181 IVFTMYDVRTNLSNQVVENVRTNLDTKIYDTLIPRNIRLAEAPSHGLPINMYDTKSAGAE 240

Query: 246 AYLKLASELIQQE 258
           +Y  LA E+++++
Sbjct: 241 SYRMLAKEVMERK 253


>gi|322421882|ref|YP_004201105.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. M18]
 gi|320128269|gb|ADW15829.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. M18]
          Length = 257

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 187/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTTA+NLS +LA     VLL+D+DPQGNA +G+G +    + S Y
Sbjct: 2   AKIICVANQKGGVGKTTTAVNLSASLAVAERRVLLVDMDPQGNAGSGVGADKDVLEESIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI +   ++I+++T +P L + P+T DL G E+ L    DR  +L + LS  L+  + 
Sbjct: 62  DALINDAPASRIVLKTELPYLQLFPATSDLAGAELELVSVTDRERKLKRILS-SLSDSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS NLLT+NAM AA S+L+PLQCEF+A+EGLSQ+L+T+  +++ +N +L I+G
Sbjct: 121 YIFIDCPPSLNLLTINAMTAAHSVLIPLQCEFYAMEGLSQILKTINLIQQGLNRSLTIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD+RN+LS+QV  ++R +   +   TVIPRNVR+SEAPS+GKP  +YD+   G+ 
Sbjct: 181 ILLTMFDARNNLSRQVGEEIRTHFPKETLQTVIPRNVRLSEAPSHGKPICLYDITSKGAT 240

Query: 246 AYLKLASELIQQE 258
           +Y++LA E+I +E
Sbjct: 241 SYMELAKEIIGRE 253


>gi|120600844|ref|YP_965418.1| cobyrinic acid a,c-diamide synthase [Shewanella sp. W3-18-1]
 gi|146295045|ref|YP_001185469.1| cobyrinic acid a,c-diamide synthase [Shewanella putrefaciens CN-32]
 gi|120560937|gb|ABM26864.1| chromosome segregation ATPase [Shewanella sp. W3-18-1]
 gi|145566735|gb|ABP77670.1| chromosome segregation ATPase [Shewanella putrefaciens CN-32]
 gi|319428563|gb|ADV56637.1| chromosome partitioning protein, ParA [Shewanella putrefaciens 200]
          Length = 262

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ YD + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYDVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+K  ++I+++       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEDKPFDEIVVKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAFVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++   + +A
Sbjct: 242 YLALAGEMIRRSEQKNQA 259


>gi|260585085|ref|ZP_05852826.1| sporulation initiation inhibitor protein Soj [Granulicatella
           elegans ATCC 700633]
 gi|260157173|gb|EEW92248.1| sporulation initiation inhibitor protein Soj [Granulicatella
           elegans ATCC 700633]
          Length = 253

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 183/249 (73%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII++ANQKGGVGKTTT ++L+ +LA +G+ VL+ID DPQGNA++GLG++  +  Y  YD
Sbjct: 3   RIISVANQKGGVGKTTTTVSLAASLAKLGQKVLIIDSDPQGNATSGLGVQKAELAYDVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++ E N++++++ T   NL I+PST+ L G E+ L  +  R  +L +AL+  +  ++ Y
Sbjct: 63  VIVNEVNVHEVIVPTTRENLMIVPSTIQLAGAEIELTNQTHREQKLKQALTT-IRDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS   LTMNA  A+D++L+P+QCE++ALEGLSQL+ T+  VR+  N  L I+G+
Sbjct: 122 IFIDCPPSLGHLTMNAFTASDTVLIPVQCEYYALEGLSQLMNTITMVRKHFNPQLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +L  +V  DV K    KVY T+IPRNVR+SEAPSYG+  + YD +  G++ 
Sbjct: 182 LLTMFDARTNLGNEVKDDVIKYFREKVYRTIIPRNVRLSEAPSYGQAIVDYDPRSRGAEV 241

Query: 247 YLKLASELI 255
           YL+LA E++
Sbjct: 242 YLELAKEVL 250


>gi|327438171|dbj|BAK14536.1| ATPase [Solibacillus silvestris StLB046]
          Length = 253

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 186/250 (74%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT++NLS  LA +G+ VL+ID+DPQGNAS+GLG+   D +   YD
Sbjct: 3   RIIAIANQKGGVGKTTTSVNLSACLAFLGKKVLIIDIDPQGNASSGLGVRKGDLESCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI +++I  ++ QT + NL I+P+T+ L G E+ L     R  RL K+L  ++ ++F +
Sbjct: 63  VLINDEDIKGVIQQTDVENLYIVPATISLAGAEIELVSTISREVRLKKSLQ-EIKNNFDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G+
Sbjct: 122 IIIDCPPSLGLLTINALTASDALIIPVQCEYYALEGLSQLLSTVRLVQKHLNKELMIDGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V++    KVY ++IPRNVR+SEAPS+GKP I+YD K  G++ 
Sbjct: 182 LLTMLDARTNLGLQVIDEVKRYFQDKVYRSIIPRNVRLSEAPSHGKPVILYDAKSRGAEI 241

Query: 247 YLKLASELIQ 256
           YL+ A E+I+
Sbjct: 242 YLEFAREVIK 251


>gi|311070638|ref|YP_003975561.1| hypothetical protein BATR1942_18565 [Bacillus atrophaeus 1942]
 gi|310871155|gb|ADP34630.1| hypothetical protein BATR1942_18565 [Bacillus atrophaeus 1942]
          Length = 253

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 128/248 (51%), Positives = 183/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++GLGIE  D  +  YD
Sbjct: 3   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVDHCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  I+  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ Y
Sbjct: 63  ILVDDADVIDIIKPTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALEA-VKQNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 122 IIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFRDKVYQTVIPRNVRLSEAPSHGKPIILYDPRSRGAEV 241

Query: 247 YLKLASEL 254
           YL LA E+
Sbjct: 242 YLDLAKEV 249


>gi|90581142|ref|ZP_01236941.1| Putative ParA family protein [Vibrio angustum S14]
 gi|90437663|gb|EAS62855.1| Putative ParA family protein [Vibrio angustum S14]
          Length = 265

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT +NL+ +LAA    VL++DLDPQGNA+   G++ Y    ++YD
Sbjct: 3   RIIAVANQKGGVGKTTTCVNLAASLAATQRKVLVVDLDPQGNATMASGVDKYQVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   N ++I+       +I +  D+   E+ L     R  RL  AL+ ++  D+ Y
Sbjct: 63  LLVEETPFNDVVIKETTGGYHLIAANGDVTAAEIKLMEVFAREVRLRTALA-KVRDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAM A+DS+LVP+QCE+FALEGL+ L++T+ ++   VNS L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMTASDSVLVPMQCEYFALEGLTALMDTISKLTAVVNSELKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+G+PA+ YD   +G++A
Sbjct: 182 LRTMFDPRNRLANEVSQQLKKHFGDKVYRTVIPRNVRLAEAPSHGRPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E+I+++
Sbjct: 242 YLALAGEMIRRD 253


>gi|117922570|ref|YP_871762.1| chromosome segregation ATPase [Shewanella sp. ANA-3]
 gi|117614902|gb|ABK50356.1| chromosome segregation ATPase [Shewanella sp. ANA-3]
          Length = 262

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK  ++I+++       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKPFDEIVVKDTTGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++   + +A
Sbjct: 242 YLALAGEMIRRSEQKTQA 259


>gi|15603937|ref|NP_220452.1| SOJ protein (soj) [Rickettsia prowazekii str. Madrid E]
 gi|3860628|emb|CAA14529.1| SOJ PROTEIN (soj) [Rickettsia prowazekii]
          Length = 255

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+I NQKGGV KTTT +NL+TA A++ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KIISIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSSTGFGIIQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   K+R + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIIATNIPNLEIITSNTNLSAAELDLTTLKEREYVLMKLLE-EVKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPSLNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAI+YD KCAG+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAILYDYKCAGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|253573867|ref|ZP_04851209.1| cobyrinic acid ac-diamide synthase [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251846344|gb|EES74350.1| cobyrinic acid ac-diamide synthase [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 253

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 183/253 (72%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT++NL   LAAIG+ VLLID+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAIANQKGGVGKTTTSVNLGAGLAAIGKKVLLIDIDPQGNTTSGVGINKADVANCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E +  + +  T I NL IIP+T+ L G E+ L     R  RL K+L   + + + 
Sbjct: 62  DVLINEVHPKEAIEHTEIENLHIIPATIQLAGAEIELVPTISREVRLKKSLQ-PIRNLYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ AADS+L+P+QCE++ALEGLSQLL TV  V++ +N++L I+G
Sbjct: 121 YILIDCPPSLGILTINSLTAADSVLIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMFDARTNLGIQVIEEVKKYFQQKVYKTVIPRNVRLSEAPSHGQSIITYDPRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            YL+LA E++  E
Sbjct: 241 VYLELAKEVVSYE 253


>gi|153002870|ref|YP_001368551.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS185]
 gi|151367488|gb|ABS10488.1| Cobyrinic acid ac-diamide synthase [Shewanella baltica OS185]
          Length = 262

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 185/258 (71%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK+ ++I+I+       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKSFDEIVIKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLAAMVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++   + +A
Sbjct: 242 YLALAGEMIRRSEQQTQA 259


>gi|302390787|ref|YP_003826608.1| chromosome segregation ATPase [Thermosediminibacter oceani DSM
           16646]
 gi|302201415|gb|ADL08985.1| chromosome segregation ATPase [Thermosediminibacter oceani DSM
           16646]
          Length = 253

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 186/250 (74%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRII IANQKGGVGKTTTAINL   LA++G+ +LL+D+DPQGN ++G+G++      S Y
Sbjct: 2   SRIIAIANQKGGVGKTTTAINLGACLASLGKRILLVDIDPQGNTTSGIGVDKTTVGESVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI E++I   +++T   NL ++PS + L G E+ L     R ++L  AL  ++  ++ 
Sbjct: 62  NVLINEESIKDNIVKTRYENLYLLPSNIQLAGAEIELVMAISREYKLKNALE-EVKQEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AAD++LVP+QCE++ALEGL QL+ T+  V++ +N  L+++G
Sbjct: 121 FILIDCPPSLGLLTLNALTAADTVLVPIQCEYYALEGLGQLMNTINLVKKHLNKGLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD +  G++
Sbjct: 181 VLLTMFDARTNLSIQVVEEVKKFFKDKVYRTIIPRNVRLSEAPSHGKPIIVYDSRSRGAE 240

Query: 246 AYLKLASELI 255
            Y++LA E++
Sbjct: 241 VYMELAKEVL 250


>gi|311032245|ref|ZP_07710335.1| hypothetical protein Bm3-1_17184 [Bacillus sp. m3-13]
          Length = 253

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII IANQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+GIE  +     Y
Sbjct: 2   GRIIAIANQKGGVGKTTTSVNLGACLAYIGKRVLLVDVDPQGNATSGVGIEKAEVHQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+    + ++ T + NLSIIP+T+ L G E+ L     R  RL +AL   +   F 
Sbjct: 62  DILVEDVEAKKAILPTKVENLSIIPATIQLAGAEIELVPTISREVRLKRALD-DVKHLFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G
Sbjct: 121 YIIIDCPPSLGLLTINALTASDAVVIPVQCEYYALEGLSQLLNTVRLVQKHLNKELMIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+P IIYD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQDKVYRTIIPRNVRLSEAPSHGEPIIIYDPKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++  
Sbjct: 241 VYLELAKEVVTH 252


>gi|154688203|ref|YP_001423364.1| hypothetical protein RBAM_038080 [Bacillus amyloliquefaciens FZB42]
 gi|154354054|gb|ABS76133.1| Soj [Bacillus amyloliquefaciens FZB42]
          Length = 253

 Score =  268 bits (685), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/248 (50%), Positives = 183/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++GLGIE  D  +  YD
Sbjct: 3   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVDHCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  I+  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ Y
Sbjct: 63  ILVDDADVTDIIKPTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 122 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFRDKVYQTIIPRNVRLSEAPSHGKPIILYDPRSRGAEV 241

Query: 247 YLKLASEL 254
           YL LA E+
Sbjct: 242 YLDLAKEV 249


>gi|126176556|ref|YP_001052705.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS155]
 gi|160877617|ref|YP_001556933.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS195]
 gi|217975457|ref|YP_002360208.1| cobyrinic acid ac-diamide synthase [Shewanella baltica OS223]
 gi|304412696|ref|ZP_07394299.1| cobyrinic acid a,c-diamide synthase [Shewanella baltica OS183]
 gi|307305839|ref|ZP_07585585.1| cobyrinic acid a,c-diamide synthase [Shewanella baltica BA175]
 gi|125999761|gb|ABN63836.1| chromosome segregation ATPase [Shewanella baltica OS155]
 gi|160863139|gb|ABX51673.1| Cobyrinic acid ac-diamide synthase [Shewanella baltica OS195]
 gi|217500592|gb|ACK48785.1| Cobyrinic acid ac-diamide synthase [Shewanella baltica OS223]
 gi|304348906|gb|EFM13321.1| cobyrinic acid a,c-diamide synthase [Shewanella baltica OS183]
 gi|306911332|gb|EFN41758.1| cobyrinic acid a,c-diamide synthase [Shewanella baltica BA175]
 gi|315269815|gb|ADT96668.1| cobyrinic acid a,c-diamide synthase [Shewanella baltica OS678]
          Length = 262

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 184/258 (71%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK  ++I+I+       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKTFDEIVIKNTAGKYDLIASNGDVTAAEIKLMEFFAREIRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLAAMVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++   + +A
Sbjct: 242 YLALAGEMIRRSEQQTQA 259


>gi|299541774|ref|ZP_07052097.1| sporulation initiation inhibitor protein soj [Lysinibacillus
           fusiformis ZC1]
 gi|298725512|gb|EFI66153.1| sporulation initiation inhibitor protein soj [Lysinibacillus
           fusiformis ZC1]
          Length = 253

 Score =  268 bits (685), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 129/250 (51%), Positives = 183/250 (73%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT++NLS  LA +G+ VLLID DPQGN ++GLGI   + +   YD
Sbjct: 3   RIIAIANQKGGVGKTTTSVNLSACLAYLGKKVLLIDTDPQGNTTSGLGINKGEIQGCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+++++  ++ +T + NLSI+P+T+ L G E+ L     R  RL  AL   +  DF Y
Sbjct: 63  VLIDDEDVQNVIQKTNVENLSIVPATISLAGAEIELVSTISREVRLKHALQ-NVKEDFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G+
Sbjct: 122 IIIDCPPSLGLLTINALTASDALIIPVQCEYYALEGLSQLLSTVRLVQKHLNQQLYIDGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+P I YD K  G++ 
Sbjct: 182 LLTMLDARTNLGLQVIDEVKKYFQDKVYKTIIPRNVRLSEAPSHGQPIITYDAKSRGAEV 241

Query: 247 YLKLASELIQ 256
           YL++A E+I+
Sbjct: 242 YLEMAREVIK 251


>gi|304405898|ref|ZP_07387556.1| cobyrinic acid ac-diamide synthase [Paenibacillus curdlanolyticus
           YK9]
 gi|304345141|gb|EFM10977.1| cobyrinic acid ac-diamide synthase [Paenibacillus curdlanolyticus
           YK9]
          Length = 257

 Score =  268 bits (684), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 126/254 (49%), Positives = 185/254 (72%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II I NQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D +   Y
Sbjct: 2   AKIIAITNQKGGVGKTTTSVNLGACLASLGKRVLLVDIDPQGNTTSGIGINKADVENCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI + +    ++ T IP L++IP+T+ L G E+ +     R  RL KAL + +  D+ 
Sbjct: 62  DILINDVHPRDAIVPTNIPGLNVIPATIQLAGAEIEMVSTISREVRLKKALHL-VKQDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ A+DS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 YILIDCPPSLGLLTINSLTASDSVLIPIQCEYYALEGLSQLLNTVRLVQKHLNTTLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMFDARTNLGIQVIEEVKKYFQQKVYQTIIPRNVRLSEAPSHGQAIITYDPRSKGAE 240

Query: 246 AYLKLASELIQQER 259
            YL+LA E+I  E+
Sbjct: 241 VYLELAKEVITYEQ 254


>gi|253702627|ref|YP_003023816.1| cobyrinic acid ac-diamide synthase [Geobacter sp. M21]
 gi|251777477|gb|ACT20058.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. M21]
          Length = 257

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 187/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTTA+NLS +LA     VLL+D+DPQGNA +G+G +    + S Y
Sbjct: 2   AKIICVANQKGGVGKTTTAVNLSASLAVAERRVLLVDMDPQGNAGSGVGADKELLEESIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI++    +I+ +T +P L + P+T DL G E+ L    DR  +L + L+  ++  + 
Sbjct: 62  DALIDDAPAARIIQRTELPYLHLFPATSDLAGAELELVSVTDRERKLKRILA-SVSDSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS NLLT+NAM AA+S+L+PLQCEF+A+EGLSQ+L+T+  +++ +NS+L I+G
Sbjct: 121 YIFIDCPPSLNLLTINAMTAANSVLIPLQCEFYAMEGLSQILKTINLIQQGLNSSLTIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD+RN+LS+QV  ++R +   +   TVIPRNVR+SEAPS+GKP  +YD+   G+ 
Sbjct: 181 ILLTMFDARNNLSRQVGEEIRTHFAKECLQTVIPRNVRLSEAPSHGKPICLYDITSKGAT 240

Query: 246 AYLKLASELIQQE 258
           +Y+ LA E+I +E
Sbjct: 241 SYMDLAKEIIGRE 253


>gi|262273121|ref|ZP_06050938.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Grimontia hollisae CIP
           101886]
 gi|262222877|gb|EEY74185.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Grimontia hollisae CIP
           101886]
          Length = 264

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 123/258 (47%), Positives = 183/258 (70%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT INL+ +LAA    VL+IDLDPQGNA+   G++ YD   ++YD
Sbjct: 3   KVIAVANQKGGVGKTTTCINLAASLAATQRKVLVIDLDPQGNATMASGVDKYDVHATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   N +++        +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEETPFNDVVVTDTTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALA-DVRENYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAM AADS+LVP+QCE+FALEGL+ L++T+ ++   VN+ L ++G+
Sbjct: 122 IFIDCPPSLNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLASVVNADLHVEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   +G+++
Sbjct: 182 LRTMYDPRNRLATEVSEQIKKHFGDKVYRTVIPRNVRLAEAPSHGKPAMYYDKHSSGAKS 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E++++E   ++A
Sbjct: 242 YLALAGEILRREEQTRQA 259


>gi|113972261|ref|YP_736054.1| chromosome segregation ATPase [Shewanella sp. MR-4]
 gi|114049510|ref|YP_740060.1| chromosome segregation ATPase [Shewanella sp. MR-7]
 gi|113886945|gb|ABI40997.1| chromosome segregation ATPase [Shewanella sp. MR-4]
 gi|113890952|gb|ABI45003.1| chromosome segregation ATPase [Shewanella sp. MR-7]
          Length = 262

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 183/258 (70%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK  + I+++       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKPFDDIVVKDTTGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++   + +A
Sbjct: 242 YLALAGEMIRRSEQKTQA 259


>gi|197120318|ref|YP_002140745.1| chromosome partitioning ATPase Soj [Geobacter bemidjiensis Bem]
 gi|197089678|gb|ACH40949.1| chromosome partitioning ATPase Soj [Geobacter bemidjiensis Bem]
          Length = 257

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 187/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTTA+NLS +LA     VLL+D+DPQGNA +G+G +    + S Y
Sbjct: 2   AKIICVANQKGGVGKTTTAVNLSASLAVAERRVLLVDMDPQGNAGSGVGADKELLEESIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI++    +I+ +T +P L + P+T DL G E+ L    DR  +L + LS  ++  + 
Sbjct: 62  DALIDDAPAARIIQRTELPYLHLFPATSDLAGAELELVSVTDRERKLKRILS-SVSDSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS NLLT+NAM AA+S+L+PLQCEF+A+EGLSQ+L+T+  +++ +NS+L I+G
Sbjct: 121 YIFIDCPPSLNLLTINAMTAANSVLIPLQCEFYAMEGLSQILKTINLIQQGLNSSLIIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD+RN+LS+QV  ++R +   +   TVIPRNVR+SEAPS+GKP  +YD+   G+ 
Sbjct: 181 ILLTMFDARNNLSRQVGEEIRTHFAKETLQTVIPRNVRLSEAPSHGKPICLYDITSRGAT 240

Query: 246 AYLKLASELIQQE 258
           +Y+ LA E+I +E
Sbjct: 241 SYMDLAKEIIGRE 253


>gi|56461728|ref|YP_157009.1| Soj family ATPase [Idiomarina loihiensis L2TR]
 gi|56180738|gb|AAV83460.1| ATPase involved in chromosome partitioning, Soj/ParA family
           [Idiomarina loihiensis L2TR]
          Length = 263

 Score =  268 bits (684), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 180/260 (69%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R I IANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ YD + + Y
Sbjct: 2   ARTIAIANQKGGVGKTTTAVNLAASMAATRRKVLLIDLDPQGNATMGSGVDKYDVENTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LLIEEK +  + ++       +I +  D    E+ L     R  RL  AL   +   + 
Sbjct: 62  ELLIEEKPVGDVAVKDTNGKYHLIAANADATAAEIKLMEVFARELRLRNALKA-VQDSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS N+LT+N MAAADSILVP+QCE++ALEGL+ L+ET+ ++   VN  L+I+G
Sbjct: 121 YIFIDCPPSLNMLTVNGMAAADSILVPMQCEYYALEGLTALMETIRQLADVVNPGLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++ + G KVY TVIPRNVR++EAPS+G PA+ YD    GS+
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKNHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSTGSK 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA ELI++  +RKE A
Sbjct: 241 AYLALAGELIRRSENRKEVA 260


>gi|269798902|ref|YP_003312802.1| cobyrinic acid ac-diamide synthase [Veillonella parvula DSM 2008]
 gi|269095531|gb|ACZ25522.1| Cobyrinic acid ac-diamide synthase [Veillonella parvula DSM 2008]
          Length = 256

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 182/255 (71%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLL+DLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLVDLDPQGNASSGLGIEKDDLELCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ + I  I+  T + NL + P+T+ L G E+ L     R   L KAL V +   + +
Sbjct: 63  VLIDGEPIADIVQPTMLENLFVAPATIQLAGAEVELVSVVSRETMLKKAL-VSVRDTYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G+
Sbjct: 122 IVIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSIQVADEVKKFFGNKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGADV 241

Query: 247 YLKLASELIQQERHR 261
           Y KLA E+I+  + +
Sbjct: 242 YTKLAKEVIKASKAK 256


>gi|114762199|ref|ZP_01441667.1| chromosome partitioning protein ParA [Pelagibaca bermudensis
           HTCC2601]
 gi|114545223|gb|EAU48226.1| chromosome partitioning protein ParA [Roseovarius sp. HTCC2601]
          Length = 269

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 139/258 (53%), Positives = 188/258 (72%), Gaps = 4/258 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  +II IANQKGGVGKTTT INL  ALA  G  +L++DLDPQGN+STGLGIE  DR+Y+
Sbjct: 8   RAPKIIAIANQKGGVGKTTTTINLGAALAEKGLKILVVDLDPQGNSSTGLGIEPDDRQYT 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           +Y+LL+++  ++  ++ T   NL +IP+T+DL   ++ L   + R F L  AL  Q   D
Sbjct: 68  TYELLLDDVALDDAILPTDQENLHLIPATVDLSSADIELVSNEKRSFLLHDALR-QTEID 126

Query: 124 ---FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              F Y+ +DCPPS NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ TV E+R++ N  
Sbjct: 127 QFGFDYVLIDCPPSLNLLTVNAMVAAHSVLVPLQSEFFALEGLSQLMLTVREIRQSANPD 186

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L I+G++LTM+D+RN+LS+QV  D R NLG  V++TVIPRNVR+SEAPSY    + YD +
Sbjct: 187 LRIEGVLLTMYDARNNLSRQVEDDARDNLGDLVFSTVIPRNVRVSEAPSYAMSVLNYDSQ 246

Query: 241 CAGSQAYLKLASELIQQE 258
             G+ AY +LA EL++++
Sbjct: 247 SKGAAAYRELADELLRKD 264


>gi|16081149|ref|NP_391977.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|221312080|ref|ZP_03593927.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|221316405|ref|ZP_03598210.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. NCIB 3610]
 gi|221321318|ref|ZP_03602612.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. JH642]
 gi|221325601|ref|ZP_03606895.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. SMY]
 gi|296330027|ref|ZP_06872511.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305676751|ref|YP_003868423.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|321313658|ref|YP_004205945.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis BSn5]
 gi|586852|sp|P37522|SOJ_BACSU RecName: Full=Sporulation initiation inhibitor protein soj
 gi|467381|dbj|BAA05227.1| regulation of Spo0J and Orf283 (probable) [Bacillus subtilis]
 gi|580906|emb|CAA44408.1| unnamed protein product [Bacillus subtilis]
 gi|2636644|emb|CAB16134.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|291486735|dbj|BAI87810.1| chromosome partitioning protein [Bacillus subtilis subsp. natto
           BEST195]
 gi|296153066|gb|EFG93931.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305414995|gb|ADM40114.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|320019932|gb|ADV94918.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus subtilis BSn5]
          Length = 253

 Score =  267 bits (683), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 128/249 (51%), Positives = 182/249 (73%), Gaps = 1/249 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++GLGIE  D +   Y
Sbjct: 2   GKIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGLGIEKADVEQCVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++ ++  I+  T + NL +IP+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  DILVDDADVIDIIKATTVENLDVIPATIQLAGAEIELVPTISREVRLKRALEA-VKQNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 YIIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLMIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAE 240

Query: 246 AYLKLASEL 254
            YL LA E+
Sbjct: 241 VYLDLAKEV 249


>gi|15616620|ref|NP_244926.1| centromere-like function involved in forespore chromosome partition
           [Bacillus halodurans C-125]
 gi|12230554|sp|Q9K5N0|SOJ_BACHD RecName: Full=Sporulation initiation inhibitor protein soj
 gi|10176683|dbj|BAB07777.1| centromere-like function involved in forespore chromosome partition
           [Bacillus halodurans C-125]
          Length = 253

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/250 (50%), Positives = 185/250 (74%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I+IANQKGGVGKTTTA+NLS  LA +G+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   AKVISIANQKGGVGKTTTAVNLSACLAHLGQRVLLVDIDPQGNATSGVGIEKGDIDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+ +   ++  T + NL ++PST+ L G E+ L     R  RL +AL  Q+   + 
Sbjct: 62  DVLVEDVDTQDVIRTTNMENLDVLPSTIQLSGAEIELVSTISREVRLKRALD-QVGRKYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS  LLT+NA+ A+DS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 FIFIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV++T+IPRNVR+ EAPS+G+P I YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFREKVFDTIIPRNVRLGEAPSHGEPIIRYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            YL LA E++
Sbjct: 241 VYLDLAKEVV 250


>gi|294792409|ref|ZP_06757556.1| sporulation initiation inhibitor protein Soj [Veillonella sp.
           6_1_27]
 gi|294456308|gb|EFG24671.1| sporulation initiation inhibitor protein Soj [Veillonella sp.
           6_1_27]
          Length = 256

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/256 (53%), Positives = 184/256 (71%), Gaps = 3/256 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLL+DLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLVDLDPQGNASSGLGIEKDDLELCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTSDFS 125
           +LI+ + I  I+  T + NL + P+T+ L G E+ L     R   L KAL SV+ T DF 
Sbjct: 63  VLIDGEPIADIVQPTMLENLFVAPATIQLAGAEVELVSVVSRETMLKKALASVRDTYDF- 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
            I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G
Sbjct: 122 -IVIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+ 
Sbjct: 181 VLLTMFDGRTNLSIQVADEVKKFFGNKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGAD 240

Query: 246 AYLKLASELIQQERHR 261
            Y KLA E+I+  + +
Sbjct: 241 VYTKLAKEVIKASKTK 256


>gi|292571655|gb|ADE29570.1| ATPase involved in chromosome partitioning [Rickettsia prowazekii
           Rp22]
          Length = 255

 Score =  267 bits (683), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 128/251 (50%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+I NQKGGV KTTT +NL+TA A++ + +L+IDLDPQGN+STG GI    RK + Y 
Sbjct: 2   KIISIVNQKGGVAKTTTTVNLATAFASVNKKILVIDLDPQGNSSTGFGIIQQQRKNTIYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L     +   +I T IPNL II S  +L   E+ L   K+R + L K L  ++   + Y
Sbjct: 62  VLTNLIELKDAIIATNIPNLEIITSNTNLSAAELDLTTLKEREYVLMKLLE-EVKILYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ NLLT+NA+ A+D +L+P+QC+F++LEGLS LL+T+E V + +N  + I GI
Sbjct: 121 IIIDCPPALNLLTVNALVASDEVLIPMQCDFYSLEGLSHLLKTIEIVEKKLNPKIKIAGI 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVRK LG  V+ TVIPRN+++SEAPSYGKPAI+YD KCAG+ A
Sbjct: 181 LFTMYDKRNRLTEQVEDDVRKCLGELVFKTVIPRNIKLSEAPSYGKPAILYDYKCAGAVA 240

Query: 247 YLKLASELIQQ 257
           Y++L  E++++
Sbjct: 241 YIELTKEILER 251


>gi|189426226|ref|YP_001953403.1| cobyrinic acid ac-diamide synthase [Geobacter lovleyi SZ]
 gi|189422485|gb|ACD96883.1| Cobyrinic acid ac-diamide synthase [Geobacter lovleyi SZ]
          Length = 257

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 186/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTTAINL+ ALAA     LL+D+DPQGNA++G+G++    ++S Y
Sbjct: 2   SKIICIANQKGGVGKTTTAINLAAALAAAERPTLLVDIDPQGNATSGVGVDKSQLQHSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLI E +   ++++T  P L I+P+T DL G E+ L  E  R  +L  ALS+ L   + 
Sbjct: 62  DLLINEADPASLVVETGHPYLHILPATADLAGAELELATETGREQKLKNALSL-LQERYR 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NAM AAD++L+PLQCEF+A+EGLSQ+L T+  V++ +N  + I+G
Sbjct: 121 YILIDCPPSLSLLTVNAMTAADTVLIPLQCEFYAMEGLSQILNTIRLVQKGLNPRIAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM D+RN LS+ V  ++R +   + +  VIPRNVR+SEAPS+GKP I YD+   G+ 
Sbjct: 181 ILLTMADARNRLSKDVEDEIRVHFPKEAFEVVIPRNVRLSEAPSHGKPIIYYDITSKGAT 240

Query: 246 AYLKLASELIQQE 258
           AYL+LA ELIQ+E
Sbjct: 241 AYLQLARELIQRE 253


>gi|294794215|ref|ZP_06759351.1| sporulation initiation inhibitor protein Soj [Veillonella sp.
           3_1_44]
 gi|294454545|gb|EFG22918.1| sporulation initiation inhibitor protein Soj [Veillonella sp.
           3_1_44]
          Length = 256

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 137/256 (53%), Positives = 184/256 (71%), Gaps = 3/256 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLL+DLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKQVLLVDLDPQGNASSGLGIEKDDLELCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTSDFS 125
           +LI+ + I  I+  T + NL + P+T+ L G E+ L     R   L KAL SV+ T DF 
Sbjct: 63  VLIDGEPIADIVQPTMLENLFVAPATIQLAGAEVELVSVVSRETMLKKALASVRDTYDF- 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
            I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G
Sbjct: 122 -IVIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+ 
Sbjct: 181 VLLTMFDGRTNLSIQVADEVKKFFGNKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGAD 240

Query: 246 AYLKLASELIQQERHR 261
            Y KLA E+I+  + +
Sbjct: 241 VYTKLAKEVIKASKTK 256


>gi|157694470|ref|YP_001488932.1| chromosome partitioning protein transcriptional regulator [Bacillus
           pumilus SAFR-032]
 gi|157683228|gb|ABV64372.1| chromosome partitioning protein transcriptional regulator [Bacillus
           pumilus SAFR-032]
          Length = 266

 Score =  267 bits (682), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 182/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NLS  LA IG+ VLL+D+DPQGNA++G+GIE  D +   YD
Sbjct: 16  KIIAITNQKGGVGKTTTSVNLSACLAYIGKRVLLVDIDPQGNATSGIGIEKADVEKCVYD 75

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  ++  T + NL +IP+T+ L G E+ L     R  RL +AL   +  ++ Y
Sbjct: 76  ILVDDADVLDVIKTTEVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDY 134

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 135 MIIDCPPSLGLLTINALTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNTDLAIEGV 194

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G+  
Sbjct: 195 LLTMLDARTNLGIQVIEEVKKYFRDKVYQTVIPRNVRLSEAPSHGKPIILYDPRSRGADV 254

Query: 247 YLKLASEL 254
           YL LA E+
Sbjct: 255 YLDLAKEV 262


>gi|91795106|ref|YP_564757.1| cobyrinic acid a,c-diamide synthase [Shewanella denitrificans
           OS217]
 gi|91717108|gb|ABE57034.1| chromosome segregation ATPase [Shewanella denitrificans OS217]
          Length = 261

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y  ++++Y+
Sbjct: 3   KIIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYGVEHTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK+ ++I+++  I    +I    D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKSFDEIVVKNTIGKYDLIAGNGDVTAAEIKLMEFYAREIRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTISKLATMVNPGLTIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRN+R++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNIRLAEAPSFGAPAMYYDKTSAGAKA 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLALAGEIIRR 252


>gi|148982409|ref|ZP_01816747.1| ParA family protein [Vibrionales bacterium SWAT-3]
 gi|145960491|gb|EDK25861.1| ParA family protein [Vibrionales bacterium SWAT-3]
          Length = 257

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ IANQKGGVGKTTT INL+ ++AA    +L++DLDPQGNA+   G++ Y  + ++YD
Sbjct: 3   RIVAIANQKGGVGKTTTCINLAASMAATKRKILVVDLDPQGNATMASGVDKYQVEATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   ++++ ++   N  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDTPFDEVVCRSTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SIRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|297569961|ref|YP_003691305.1| Cobyrinic acid ac-diamide synthase [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925876|gb|ADH86686.1| Cobyrinic acid ac-diamide synthase [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 270

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 196/275 (71%), Gaps = 18/275 (6%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           + E++++++ +ANQKGGVGKTTTAINL+ ++AA+G+ VL++D DPQGNAS+GLG   +D+
Sbjct: 3   LNERRAKVVAMANQKGGVGKTTTAINLAASVAALGKRVLVVDSDPQGNASSGLG---WDK 59

Query: 61  KYSS---------YDLLIEEKNINQILIQTA--IPNLSIIPSTMDLLGIEMILGGEKDRL 109
           + S          Y  L++     + ++  A     L ++PS +DL+G+E+ L G   R 
Sbjct: 60  QSSQGGEEEALHLYHCLLDGVPAREAIVTVADLKGKLGVLPSRIDLIGVEVELMGASKRE 119

Query: 110 FRLDKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLET 169
             L+  L   +  ++ Y+F+DCPPS  LLT+NA+ AADS+++PLQCE+FALEGLSQL+ T
Sbjct: 120 RYLENLLD-PVMDEYDYVFVDCPPSLGLLTINALTAADSVIIPLQCEYFALEGLSQLVRT 178

Query: 170 VEEVRRTVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPS 229
           +  V+ + N  L I+G++LTMFD RN L+ QV S+V ++  G++Y TVIPRNVR+SEAPS
Sbjct: 179 IRLVKNSYNERLVIEGVLLTMFDGRNRLTHQVASEVNEHFKGRLYKTVIPRNVRLSEAPS 238

Query: 230 YGKPAIIYDLKCAGSQAYLKLASELIQQERHRKEA 264
           YGKPA++YD + +G+ +YL+LA E +   RH+K++
Sbjct: 239 YGKPALLYDRRSSGAVSYLQLAKEFL---RHQKKS 270


>gi|9968459|emb|CAC06097.1| ParA protein [Listeria monocytogenes]
          Length = 250

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 187/250 (74%), Gaps = 1/250 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTT+++NLS++LA +G+ VLL+D+DPQGNAS+G+G+   + ++  YD+
Sbjct: 1   MIALANQKGGVGKTTSSVNLSSSLAFLGKKVLLVDIDPQGNASSGVGVNKGEIEHCIYDV 60

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           L+++  I  +L +T + NL++IP+T+ L G E+ L     R  RL KA+   +  D+ Y+
Sbjct: 61  LVDDVAIQDVLQKTDLDNLNVIPATIQLAGAEVELVPAISREIRLKKAID-SIRDDYDYV 119

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T+  V++ +N  L I+G++
Sbjct: 120 IIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTIRIVQKHLNEDLQIEGVL 179

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM D+R +L  QV+ +V+K    KV+NT+IP NVR+SEAPS+GKP ++YD K  G++ Y
Sbjct: 180 LTMLDARTNLGIQVIEEVKKYFQNKVFNTIIPWNVRLSEAPSHGKPILLYDAKSKGAEVY 239

Query: 248 LKLASELIQQ 257
           L+LA E++  
Sbjct: 240 LELAKEVVAH 249


>gi|39995217|ref|NP_951168.1| soj protein [Geobacter sulfurreducens PCA]
 gi|39981979|gb|AAR33441.1| soj protein [Geobacter sulfurreducens PCA]
 gi|298504221|gb|ADI82944.1| chromosome partitioning ATPase Soj [Geobacter sulfurreducens KN400]
          Length = 257

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/256 (48%), Positives = 190/256 (74%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTTA+NL+ +LAA  +  LL+D+DPQGNA +G+G++    + S Y
Sbjct: 2   AKIICIANQKGGVGKTTTAVNLAASLAAAEKQTLLVDMDPQGNAGSGVGVDKAGLEESVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D +I + + + +++ T + +L ++PST DL G E+ L    +R  RL  AL+ +L+  + 
Sbjct: 62  DAIINDVDPSGLIVGTDLAHLDLLPSTTDLAGAELELVSMPERERRLKAALA-RLSQRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NAM AADS+L+PLQCE++A+EGLSQ+++T++ V++ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTVNAMTAADSVLIPLQCEYYAMEGLSQIIKTIKLVQKGLNPGLAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D RN+LS+QV  ++R +     + TVIPRNVR+SEAPS+G+P I+YD+   G+ 
Sbjct: 181 IVLTMYDGRNNLSRQVSEEIRGHFADIAFQTVIPRNVRLSEAPSHGRPVILYDITSRGAV 240

Query: 246 AYLKLASELIQQERHR 261
           +Y++LA EL+ +E  R
Sbjct: 241 SYMELARELMTREVRR 256


>gi|121535382|ref|ZP_01667194.1| Cobyrinic acid a,c-diamide synthase [Thermosinus carboxydivorans
           Nor1]
 gi|121306074|gb|EAX47004.1| Cobyrinic acid a,c-diamide synthase [Thermosinus carboxydivorans
           Nor1]
          Length = 253

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 182/249 (73%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NLS  LA +G+ VLL+D+DPQGN+++GLG+     K+  YD
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLSACLAELGKKVLLVDIDPQGNSTSGLGVNKASIKHCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI +  +  +L+ T +PNL ++P+T+ L G E+ L     R  +L +AL  ++   + Y
Sbjct: 63  ALINDVPVETLLLPTELPNLMLLPATIQLAGAEIELVSLMSRETKLKRALD-KVKYKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ AA+S+++P+QCEF+ALEGL+QL+ T+  V++ +N  L ++G+
Sbjct: 122 IIIDCPPSLGLLTINSLTAANSVIIPIQCEFYALEGLTQLMNTISLVQKNLNPVLTLEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +LS QVV +V+ +   KVY T+IPRNVR+SEAPS+GKP I YD K  G++ 
Sbjct: 182 VLTMFDARTNLSIQVVDEVKNHFRHKVYQTIIPRNVRLSEAPSHGKPVIKYDPKSKGAEV 241

Query: 247 YLKLASELI 255
           Y  LA E+I
Sbjct: 242 YFDLAKEVI 250


>gi|222152194|ref|YP_002561354.1| chromosome partitioning protein ParA homolog [Macrococcus
           caseolyticus JCSC5402]
 gi|222121323|dbj|BAH18658.1| chromosome partitioning protein ParA homolog [Macrococcus
           caseolyticus JCSC5402]
          Length = 253

 Score =  266 bits (681), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 184/250 (73%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ IANQKGGVGKTTT++NLS AL+ +G+ VLL+D DPQGNA++G+GI+  +   S Y
Sbjct: 2   TKILAIANQKGGVGKTTTSVNLSAALSELGKKVLLVDTDPQGNATSGVGIDKNNVTNSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+ +IN+ +++TA  NL IIP+ + L G E+ L     R  RL  A   +L  DF 
Sbjct: 62  DMLVEDTDINKCVLETAQENLYIIPANIALAGAEIELVSAMSREVRLKYAFK-ELNEDFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N+  AA  I++P+QCE++ALEGLSQLL T++ V+R +N +L I+G
Sbjct: 121 YIIIDCPPSLGLLTINSFTAASGIIIPVQCEYYALEGLSQLLNTIKLVQRHLNQSLVIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L   V+++V+ +   KVY T+IPRNVR+SEAPS+G+P  +YD +  G++
Sbjct: 181 VLLTMYDARTNLGNDVIAEVKAHFEDKVYETIIPRNVRLSEAPSHGQPINVYDARSTGAK 240

Query: 246 AYLKLASELI 255
            Y  LA E+I
Sbjct: 241 TYKSLAEEVI 250


>gi|291520335|emb|CBK75556.1| ATPases involved in chromosome partitioning [Butyrivibrio
           fibrisolvens 16/4]
          Length = 256

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 185/253 (73%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I IANQKGGVGKTTT+INLS  LA  G+ VL+ID DPQGNA++GLG++  + + + YD
Sbjct: 3   RVIAIANQKGGVGKTTTSINLSACLAEAGKKVLVIDTDPQGNATSGLGLDKEECENTVYD 62

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           L++++ +I + + +   IPNL+IIPS +DL G E+ L G  ++ + L  A+   +  DF 
Sbjct: 63  LVLDQCSIKECMYKVENIPNLTIIPSNVDLAGAEIELLGINEKEYILRNAVD-YVKDDFD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS N+LT+NAM  ADS+LVP+QCE++ALEG+SQL+ T++ V+  +NS L I G
Sbjct: 122 YVIIDCPPSLNMLTINAMTTADSVLVPIQCEYYALEGISQLIHTIDLVQERLNSKLKIDG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D+R +LS  VV  V+ NL   VY T+IPRNVR++EAPS+G P  +YD K  G++
Sbjct: 182 VVFTMYDARTNLSSDVVDTVKNNLNATVYQTIIPRNVRLAEAPSHGLPINLYDSKSTGAE 241

Query: 246 AYLKLASELIQQE 258
           +Y  LA E+I ++
Sbjct: 242 SYRNLAKEIIGRK 254


>gi|85712596|ref|ZP_01043643.1| ATPase involved in chromosome partitioning, Soj/ParA family protein
           [Idiomarina baltica OS145]
 gi|85693587|gb|EAQ31538.1| ATPase involved in chromosome partitioning, Soj/ParA family protein
           [Idiomarina baltica OS145]
          Length = 265

 Score =  266 bits (680), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 132/257 (51%), Positives = 184/257 (71%), Gaps = 4/257 (1%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I IANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ Y+   + Y+LL
Sbjct: 5   IAIANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYEVDSTVYELL 64

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTSDFSYI 127
           ++EK I ++++        +I +  D+   E+ L     R  RL  AL SVQ   D+ +I
Sbjct: 65  VDEKPIKEVVVTDTNGKYHLIAANSDVTAAEIKLMEFFAREVRLRNALKSVQ--DDYDFI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
           F+DCPPS N+LT+NAMAAADSILVP+QCE++ALEGL+ L+ET+ ++   VNS+L I+GI+
Sbjct: 123 FIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMETIRQLAEVVNSSLTIEGIL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
            TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD    G++AY
Sbjct: 183 RTMYDPRNRLANDVSEQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSTGAKAY 242

Query: 248 LKLASELIQQ-ERHRKE 263
           L LA E+I++ E+  KE
Sbjct: 243 LSLAGEIIRRAEKLEKE 259


>gi|296134491|ref|YP_003641738.1| Cobyrinic acid ac-diamide synthase [Thermincola sp. JR]
 gi|296033069|gb|ADG83837.1| Cobyrinic acid ac-diamide synthase [Thermincola potens JR]
          Length = 253

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 186/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGV KTTTA+NL+  LA   + VLL+D+DPQGNAS+GLGIE  +  +  YD
Sbjct: 3   KVIAVANQKGGVAKTTTAVNLAACLALNDKKVLLLDIDPQGNASSGLGIEKDETLHCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++I    I  ++ +T I NL ++P+T+ L G E+ L     R  +L KAL+  +   + Y
Sbjct: 63  VIINGVPIESVIAKTEIENLEVVPATIQLAGAEIELVSAISRESKLKKALA-PIRDRYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGL QL+ T+E VR+ +N+ L+I+G+
Sbjct: 122 VLIDCPPSLGLLTLNALTAADSLIIPIQCEYYALEGLGQLMNTIELVRKHLNANLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +LS QVV +V++    KVY T++PRNVR+SEAPS+GKP ++YD +  G++ 
Sbjct: 182 LLTMFDARTNLSIQVVDEVKEYFKDKVYRTIVPRNVRLSEAPSHGKPIVLYDPRSRGAEV 241

Query: 247 YLKLASELIQQE 258
           Y +LA E+I++E
Sbjct: 242 YQELAKEVIERE 253


>gi|251800241|ref|YP_003014972.1| cobyrinic acid ac-diamide synthase [Paenibacillus sp. JDR-2]
 gi|247547867|gb|ACT04886.1| Cobyrinic acid ac-diamide synthase [Paenibacillus sp. JDR-2]
          Length = 257

 Score =  266 bits (679), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/254 (50%), Positives = 181/254 (71%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT++NL   LA +G  VLL+D+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAIANQKGGVGKTTTSVNLGACLATLGRRVLLVDIDPQGNTTSGIGINKADVNNCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI + +    + +T I  L IIP+T+ L G E+ +     R  RL KALS+ +   F 
Sbjct: 62  DVLINDVHPKDAMFETKIDGLKIIPATIQLAGAEIEMVPTISRELRLKKALSL-VKDQFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ AADS+++P+QCE++ALEGLSQLL TV  V++ +N+AL I+G
Sbjct: 121 YILIDCPPSLGLLTINSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTALQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQQKVYQTIIPRNVRLSEAPSHGEAIITYDPRSKGAE 240

Query: 246 AYLKLASELIQQER 259
            YL+LA E+I  E+
Sbjct: 241 VYLELAKEVIMYEQ 254


>gi|114565204|ref|YP_752718.1| cobyrinic acid a,c-diamide synthase [Shewanella frigidimarina NCIMB
           400]
 gi|114336497|gb|ABI73879.1| chromosome segregation ATPase [Shewanella frigidimarina NCIMB 400]
          Length = 262

 Score =  265 bits (678), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KIIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK   +I+I+  I    +I    D+   E+ L     R  RL  AL+  +  D+ +
Sbjct: 63  LLVEEKPFAEIVIKNTIGKYDLIAGNGDVTAAEIKLMEFYAREIRLRNALA-PIKDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALIDTITKLGAMVNPTLSIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+I++   + +
Sbjct: 242 YLALAGEIIRRAEQQTQ 258


>gi|312115375|ref|YP_004012971.1| cobyrinic acid ac-diamide synthase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220504|gb|ADP71872.1| cobyrinic acid ac-diamide synthase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 282

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 185/260 (71%), Gaps = 8/260 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+  +ANQKGGVGKTTTAINL TALAA GE VL+IDLDPQGNASTGLG+    R  S+YD
Sbjct: 11  RVFAVANQKGGVGKTTTAINLGTALAAAGERVLVIDLDPQGNASTGLGVPEEARHVSTYD 70

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF-- 124
           +L     + Q +   AIP L + PST DL G+E  +    +R + L  A++    S+   
Sbjct: 71  VLAGAAALEQAMTPAAIPGLFVAPSTRDLAGLEPEIAAAPNRAYFLRDAIASLRASELDR 130

Query: 125 ------SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
                 SY+ +DCPPS ++LT+NA+AAAD+ LVP+QCEFFALEG+ QL ET++ V+ ++N
Sbjct: 131 APADRLSYVLIDCPPSLSILTLNALAAADAALVPVQCEFFALEGIQQLKETIDFVQASLN 190

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L+I G++LTM D R  LS +V ++VR   G KVY+T+IPRNVRI+EAPS+GKP ++YD
Sbjct: 191 PGLEIHGVVLTMHDGRTRLSNEVATEVRSFFGQKVYDTIIPRNVRIAEAPSHGKPLLLYD 250

Query: 239 LKCAGSQAYLKLASELIQQE 258
              AGS+AY+ LA+E+I +E
Sbjct: 251 HTSAGSKAYMDLAAEMITRE 270


>gi|86147163|ref|ZP_01065479.1| ParA family protein [Vibrio sp. MED222]
 gi|218711032|ref|YP_002418653.1| ParA family protein [Vibrio splendidus LGP32]
 gi|85835047|gb|EAQ53189.1| ParA family protein [Vibrio sp. MED222]
 gi|218324051|emb|CAV20413.1| ParA family protein [Vibrio splendidus LGP32]
          Length = 257

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 184/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    +L++DLDPQGNA+   G++ Y  + ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKILVVDLDPQGNATMASGVDKYQVEATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   ++++ ++   N  +I +  D+   E+ L     R  RL  AL+  + +++ +
Sbjct: 63  LLVEDTPFDEVVCRSTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SIRNNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|303228576|ref|ZP_07315403.1| sporulation initiation inhibitor protein Soj [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516755|gb|EFL58670.1| sporulation initiation inhibitor protein Soj [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 257

 Score =  265 bits (678), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 182/256 (71%), Gaps = 1/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLLIDLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLIDLDPQGNASSGLGIEKDDLELCIHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ ++I  ++  T +  L + P+T+ L G E+ L G   R   L KA++  +  ++ +
Sbjct: 63  VLIDSEDIAHVIQPTMLKKLFVAPATIQLAGAEVELVGIVSRETILKKAIA-SVRDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L I+G+
Sbjct: 122 IIIDCPPSLGLLTLNAFTAADSVLIPIQTEFYALEGVSQLVKTITIVQQTSNKDLVIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+   G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSVQVADEVKSFFGTKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGAAV 241

Query: 247 YLKLASELIQQERHRK 262
           Y KLA E+I+  +  K
Sbjct: 242 YTKLAKEVIRDSKKTK 257


>gi|88705408|ref|ZP_01103119.1| sporulation initiation inhibitor protein Soj [Congregibacter
           litoralis KT71]
 gi|88700498|gb|EAQ97606.1| sporulation initiation inhibitor protein Soj [Congregibacter
           litoralis KT71]
          Length = 265

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTT +NL+ +LAA+ + VLL+DLDPQGNAS G G++ Y  K S Y
Sbjct: 2   ARIIAIANQKGGVGKTTTCVNLAASLAAMRKRVLLVDLDPQGNASMGSGVDKYSLKRSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E   +   +   A     ++P+  D+   E+ L     R  RL  AL  Q+ S + 
Sbjct: 62  DVLVEACGVADAVQDAAEGGFMVLPANGDVTAAEVELIQVDGRERRLRAALG-QVQSSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS NLLT+N + AAD +++ +QCE+FALEGLS LL+T+E+VR +VN  L+++G
Sbjct: 121 YILIDCPPSLNLLTLNGLVAADGVIIAMQCEYFALEGLSALLDTIEQVRSSVNVGLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+  V S + ++ G KVY TVIPRNVR++EAPS+G PA+ YD    GS+
Sbjct: 181 ILRTMYDPRNSLTNAVSSQLHEHFGEKVYRTVIPRNVRLAEAPSHGVPAMHYDKYSRGSR 240

Query: 246 AYLKLASELIQQE 258
           AY+ LA E+I++E
Sbjct: 241 AYMALAGEMIRRE 253


>gi|238018237|ref|ZP_04598663.1| hypothetical protein VEIDISOL_00061 [Veillonella dispar ATCC 17748]
 gi|237864708|gb|EEP65998.1| hypothetical protein VEIDISOL_00061 [Veillonella dispar ATCC 17748]
          Length = 256

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 182/255 (71%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLL+DLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLVDLDPQGNASSGLGIEKDDLELCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ + I  I+  T +  L + P+T+ L G E+ L     R   L KAL+  +  ++ +
Sbjct: 63  VLIDGEPIADIVQPTMLKKLFVAPATIQLAGAEVELVSVVSRETMLKKALA-PVRDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G+
Sbjct: 122 IIIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSIQVADEVKKFFGNKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGADV 241

Query: 247 YLKLASELIQQERHR 261
           Y KLA E+I+  + +
Sbjct: 242 YTKLAKEVIKASKAK 256


>gi|147679249|ref|YP_001213464.1| ATPase [Pelotomaculum thermopropionicum SI]
 gi|146275346|dbj|BAF61095.1| ATPase [Pelotomaculum thermopropionicum SI]
          Length = 256

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 186/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I IANQKGGV KTTTA+NL   L+ +G+ VLL+D D QGNA+TG+G++    +   YD
Sbjct: 6   KTIAIANQKGGVAKTTTAVNLGAWLSLMGKKVLLVDTDSQGNATTGVGVDKNSLEKCLYD 65

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            +IE   + +I++Q+A+ NL ++P+T++L G E+ L G  +R   L  ALS  +  D+ Y
Sbjct: 66  AIIEGVPLREIIVQSAVENLDLVPATIELAGAEIELVGVPEREKILKAALS-GVKDDYEY 124

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  L+T+NA+AAADS+L+P+QCEF+ALEGLSQLL T + V++ +NS+L ++G+
Sbjct: 125 ILIDCPPSLGLMTINALAAADSLLIPIQCEFYALEGLSQLLNTFKMVQQRLNSSLVLEGV 184

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QVV +V+K+   KV+  +IPRNVR+SEAPSYGKP ++YD +  G++ 
Sbjct: 185 LLTMFDGRTNLSIQVVEEVKKHFRDKVFKAIIPRNVRLSEAPSYGKPVMVYDRRSRGAEV 244

Query: 247 YLKLASELIQQE 258
           Y +LA E++  E
Sbjct: 245 YRELAKEVMGIE 256


>gi|301062064|ref|ZP_07202766.1| sporulation initiation inhibitor protein Soj [delta proteobacterium
           NaphS2]
 gi|300443830|gb|EFK07893.1| sporulation initiation inhibitor protein Soj [delta proteobacterium
           NaphS2]
          Length = 256

 Score =  265 bits (677), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 127/255 (49%), Positives = 184/255 (72%), Gaps = 1/255 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I+I+NQKGGVGKTTTA+NLS ALAA  +  LLID DPQGNA+TGLG+++ D  +  Y
Sbjct: 2   TQVISISNQKGGVGKTTTAVNLSAALAAGEKTCLLIDCDPQGNATTGLGVDIADLSHGLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+    +   L +TA+P+L ++ +T +L+G E+ +     + F L K +++ L   + 
Sbjct: 62  DILMGTAPVETALTETALPHLHLLGATRELIGAEVEMASMSSKEFLLKKPIAM-LRKRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+NA+ A+ S+LVPLQCE++ALEGLS+LL TV+ V++ +N  L    
Sbjct: 121 YIFIDCPPSLGFLTINALTASASVLVPLQCEYYALEGLSKLLTTVKAVKKRLNPVLRRVD 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM D RN+LS+QV  + R     +V  TVIPRNVR+SEAPSYGKP I+YD++  G+Q
Sbjct: 181 ILLTMHDKRNNLSRQVEQEARGLFNERVLKTVIPRNVRLSEAPSYGKPIILYDIRSPGAQ 240

Query: 246 AYLKLASELIQQERH 260
           +YL LA E+++ E+ 
Sbjct: 241 SYLALAREIVESEKR 255


>gi|166032902|ref|ZP_02235731.1| hypothetical protein DORFOR_02623 [Dorea formicigenerans ATCC
           27755]
 gi|166027259|gb|EDR46016.1| hypothetical protein DORFOR_02623 [Dorea formicigenerans ATCC
           27755]
          Length = 254

 Score =  265 bits (677), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 187/253 (73%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT+INL+  LA  G+ VL +D+DPQGN ++GLG++    + S Y+
Sbjct: 3   RIIAVANQKGGVGKTTTSINLAACLAEKGKKVLAVDMDPQGNLTSGLGVDKDSVEKSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I E +I +++ +  + NL IIP+++DL   E+ L G  D+ + L  A+  Q+   + +
Sbjct: 63  LIIGEVDIKEVINKEVLENLDIIPTSIDLSAAEIELIGVDDKEYILRNAID-QVKDQYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS ++LT+NAM  ADS++VP+QCE++ALEGLSQL+ TVE V+  +NS L+I+G+
Sbjct: 122 VIIDCPPSLSMLTINAMTTADSVIVPIQCEYYALEGLSQLIHTVELVKDRLNSKLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P   YD K  G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLQQNIYKTIIPRNIRLAEAPSYGLPINKYDPKSTGAES 241

Query: 247 YLKLASELIQQER 259
           Y++LA E+I++E 
Sbjct: 242 YMRLADEVIEREE 254


>gi|239828703|ref|YP_002951327.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. WCH70]
 gi|239808996|gb|ACS26061.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. WCH70]
          Length = 253

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I IANQKGGVGKTTTA+NL+  LA IG+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   GKVIAIANQKGGVGKTTTAVNLAACLAHIGKKVLLVDIDPQGNATSGIGIEKGDVDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +++I +     ++  T I NL IIP+T+ L G E+ L     R  RL  AL   L   + 
Sbjct: 62  NVIIGDLKAKDVIRPTNIENLHIIPATIQLAGAEIELVSVISREIRLKNALD-PLREAYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA+S+L+P+QCE++ALEGLSQLL T+  V++ +N  L ++G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAANSVLIPVQCEYYALEGLSQLLNTIRLVQKHLNHDLRLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVYNT+IPRNVR+SEAPS+GKP I+YD+K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIQEVKKYFREKVYNTIIPRNVRLSEAPSHGKPIILYDVKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++++
Sbjct: 241 VYLELAKEVLER 252


>gi|303230668|ref|ZP_07317418.1| sporulation initiation inhibitor protein Soj [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514723|gb|EFL56715.1| sporulation initiation inhibitor protein Soj [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 257

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 182/256 (71%), Gaps = 1/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLLIDLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLIDLDPQGNASSGLGIEKDDLELCIHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ ++I  ++  T +  L + P+T+ L G E+ L G   R   L KA++  +  ++ +
Sbjct: 63  VLIDSEDIANVIQPTMLKKLFVAPATIQLAGAEVELVGIVSRETILKKAIA-SVRDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L I+G+
Sbjct: 122 IIIDCPPSLGLLTLNAFTAADSVLIPIQTEFYALEGVSQLVKTITIVQQTSNKDLVIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+   G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSVQVADEVKSFFGTKVYKTIIPRNVRLSEAPSYGEPIIVYDSKSKGAAV 241

Query: 247 YLKLASELIQQERHRK 262
           Y KLA E+I+  +  K
Sbjct: 242 YTKLAKEVIRDSKKTK 257


>gi|258404140|ref|YP_003196882.1| Cobyrinic acid ac-diamide synthase [Desulfohalobium retbaense DSM
           5692]
 gi|257796367|gb|ACV67304.1| Cobyrinic acid ac-diamide synthase [Desulfohalobium retbaense DSM
           5692]
          Length = 270

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTTAINL+ +LAA+ + VL++D DPQ NAS+GLGI     K S Y+
Sbjct: 7   QIIVLANQKGGVGKTTTAINLAASLAAMEKRVLVVDCDPQANASSGLGIASDTGKGSIYE 66

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L   + I   +  + +  L ++PST DL+G E+ L     R F L +AL   +   + Y
Sbjct: 67  ALFSPERITDAIYPSQLDYLDVVPSTPDLVGAELELVDRIGREFYLREALQ-NIGQGYEY 125

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDCPPS  L+T+NA+ AA+++LVPLQCE++ALEG++ L+ T E VR+ +N  LD  G+
Sbjct: 126 ILLDCPPSLGLVTVNALCAANALLVPLQCEYYALEGIAHLMRTYELVRKRLNPGLDFLGV 185

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN LS QV ++VR    GK + T+IPRNVR+SEAPSYGKPA+ YD +  G+QA
Sbjct: 186 VLTMFDRRNRLSTQVRNEVRNYFAGKAFETIIPRNVRLSEAPSYGKPALCYDHRSKGTQA 245

Query: 247 YLKLASELIQQ 257
           YL LASEL ++
Sbjct: 246 YLALASELTRR 256


>gi|167770822|ref|ZP_02442875.1| hypothetical protein ANACOL_02175 [Anaerotruncus colihominis DSM
           17241]
 gi|167666862|gb|EDS10992.1| hypothetical protein ANACOL_02175 [Anaerotruncus colihominis DSM
           17241]
          Length = 274

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 185/261 (70%), Gaps = 1/261 (0%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
            EK  +II +ANQKGGVGKTTTA+NL+ AL A G   LL+D+DPQGN+++GLGI      
Sbjct: 13  REKMGKIIAVANQKGGVGKTTTAVNLTAALGARGYRTLLVDVDPQGNSTSGLGINKRSLA 72

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            S+Y+LL+      Q L  T   N+ ++PS + L G E+ L    +R  RL  AL +++ 
Sbjct: 73  CSTYELLVSTAGAEQALQHTPFQNVDVLPSNISLAGAEIELVELDNRAMRLKTAL-LRIR 131

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
             + +I +DCPPS  ++T+NA AAA+S+L+P+QCE++ALEGLSQL+ T+ +V+R  N  +
Sbjct: 132 DQYDFILIDCPPSLGIITLNAFAAANSLLIPIQCEYYALEGLSQLIATLRQVKRLYNPDI 191

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           DI+G++LTM+DSR +L+ QVV++++K    K+Y+TVIPRNVR+SEAPS+G+P + YD   
Sbjct: 192 DIEGVLLTMYDSRLNLTVQVVAELKKYFPQKIYHTVIPRNVRLSEAPSFGQPVLYYDRSS 251

Query: 242 AGSQAYLKLASELIQQERHRK 262
            GS AY +LA E +++ R ++
Sbjct: 252 KGSAAYEELAEEFLKKNRKKR 272


>gi|28899852|ref|NP_799457.1| ParA family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838482|ref|ZP_01991149.1| ParA family protein [Vibrio parahaemolyticus AQ3810]
 gi|260361982|ref|ZP_05774987.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus K5030]
 gi|260876531|ref|ZP_05888886.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus AN-5034]
 gi|260897412|ref|ZP_05905908.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus Peru-466]
 gi|28808104|dbj|BAC61341.1| ParA family protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748105|gb|EDM58964.1| ParA family protein [Vibrio parahaemolyticus AQ3810]
 gi|308087926|gb|EFO37621.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus Peru-466]
 gi|308090374|gb|EFO40069.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus AN-5034]
 gi|308114192|gb|EFO51732.1| sporulation initiation inhibitor protein Soj [Vibrio
           parahaemolyticus K5030]
 gi|328471203|gb|EGF42105.1| ParA family protein [Vibrio parahaemolyticus 10329]
          Length = 257

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   +Q++         +I +  D+   E+ L     R  RL  ALS  +  ++ +
Sbjct: 63  LLVEETPFDQVVCTQTTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALST-VRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|24376228|ref|NP_720272.1| ParA family protein [Shewanella oneidensis MR-1]
 gi|24351288|gb|AAN57715.1|AE015907_13 ParA family protein [Shewanella oneidensis MR-1]
          Length = 262

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 126/254 (49%), Positives = 180/254 (70%), Gaps = 1/254 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK  + I+++       +I S  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLVEEKPFDDIVVKDTAGKYDLIASNGDVTAAEIKLMEFFAREVRLRNALA-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTITKLAAVVNPGLGIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERH 260
           YL LA E+I++   
Sbjct: 242 YLALAGEMIRRSEQ 255


>gi|254483180|ref|ZP_05096413.1| putative CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [marine gamma proteobacterium HTCC2148]
 gi|214036551|gb|EEB77225.1| putative CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [marine gamma proteobacterium HTCC2148]
          Length = 298

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 181/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I IANQKGGVGKTTT INL+ +LAA+   VLL+DLDPQGNA+ G GI+ Y  K S+Y
Sbjct: 30  ARVIAIANQKGGVGKTTTCINLAASLAAMNRRVLLVDLDPQGNATMGSGIDKYSVKRSTY 89

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+    ++Q+    A     ++PS  DL   E+ L   + +  RL  AL ++ ++ + 
Sbjct: 90  DVLVHRAPVSQVAQHAADSGFDVLPSNSDLTAAEVELIEVEHKERRLRAAL-IEASAAYD 148

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS N+LT+NA+ AAD +++ +QCE+FALEGLS L+ T+ ++  +VNS L ++G
Sbjct: 149 YMLIDCPPSLNMLTLNALVAADGVIITMQCEYFALEGLSDLVRTISQIAESVNSELQVEG 208

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+ +V + + K+ G KVY TV+PRNVR++EAPS+G PA+ YD    GS+
Sbjct: 209 ILRTMYDPRNSLTNEVSNQLHKHFGDKVYRTVVPRNVRLAEAPSHGIPAMYYDKFSRGSK 268

Query: 246 AYLKLASELIQQE 258
           AY+ LA E+I++E
Sbjct: 269 AYMALAGEIIRRE 281


>gi|319651091|ref|ZP_08005225.1| chromosome partitioning protein [Bacillus sp. 2_A_57_CT2]
 gi|317397261|gb|EFV77965.1| chromosome partitioning protein [Bacillus sp. 2_A_57_CT2]
          Length = 253

 Score =  265 bits (676), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 184/249 (73%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+GIE  D  +  YD
Sbjct: 3   KIIAVANQKGGVGKTTTSVNLGACLAYIGKKVLLVDIDPQGNATSGIGIEKADVDHCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++   ++++  T++ NL  IP+T+ L G E+ L     R  RL +AL  ++ ++F Y
Sbjct: 63  VLVDDVEASKVIKSTSVENLYAIPATIQLAGAEIELVPTISREVRLKRALE-EVRANFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+N++ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I+G+
Sbjct: 122 VIIDCPPSLGLLTINSLTASDAVIIPVQCEYYALEGLSQLLNTVRLVQKHLNHDLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+ EAPS+G+P I YD K  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFQDKVYKTIIPRNVRLGEAPSHGEPIITYDPKSRGAEV 241

Query: 247 YLKLASELI 255
           YL+LA E++
Sbjct: 242 YLELAKEVV 250


>gi|94967072|ref|YP_589120.1| chromosome segregation ATPase [Candidatus Koribacter versatilis
           Ellin345]
 gi|94549122|gb|ABF39046.1| chromosome segregation ATPase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 273

 Score =  264 bits (675), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 188/257 (73%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTAINL+ +LAA     LLID DPQ NAS+GLG      + SSY+
Sbjct: 3   KVIAIANQKGGVGKTTTAINLAASLAAAEVPTLLIDCDPQSNASSGLGFGKDPNRLSSYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+     + +L  TA+  L +IP++ +L+G  + L   + R +RL  A+ V L  +F +
Sbjct: 63  LLMGTAPASDVLQHTALEELQLIPASKNLIGANIELVMMERREYRLRDAIQV-LKENFEF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ +LLT+N++ AADS+LVP+Q E+FALEG+S+LL+TVE +R + N  L ++G+
Sbjct: 122 IVIDCPPALDLLTLNSLVAADSVLVPMQAEYFALEGVSELLDTVERIRESYNPELAVEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +L+Q V S+++   G ++ +T IPRNVR++EAPS+GKPA++YD K  G+++
Sbjct: 182 VLTMFDDRTNLAQSVASELKSYFGERLCDTQIPRNVRLAEAPSHGKPALLYDPKSRGAES 241

Query: 247 YLKLASELIQQERHRKE 263
           Y+KLA E+IQ+ R++ +
Sbjct: 242 YIKLAKEVIQKHRNKAQ 258


>gi|15642766|ref|NP_232399.1| ParA family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121591530|ref|ZP_01678793.1| ParA family protein [Vibrio cholerae 2740-80]
 gi|147674665|ref|YP_001218412.1| ParA family protein [Vibrio cholerae O395]
 gi|153212971|ref|ZP_01948565.1| ParA family protein [Vibrio cholerae 1587]
 gi|153803599|ref|ZP_01958185.1| ParA family protein [Vibrio cholerae MZO-3]
 gi|153820113|ref|ZP_01972780.1| ParA family protein [Vibrio cholerae NCTC 8457]
 gi|153821959|ref|ZP_01974626.1| ParA family protein [Vibrio cholerae B33]
 gi|153829670|ref|ZP_01982337.1| ParA family protein [Vibrio cholerae 623-39]
 gi|227082885|ref|YP_002811436.1| ParA family protein [Vibrio cholerae M66-2]
 gi|229508286|ref|ZP_04397790.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae BX
           330286]
 gi|229508638|ref|ZP_04398133.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae B33]
 gi|229515960|ref|ZP_04405417.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae TMA
           21]
 gi|229517146|ref|ZP_04406592.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae RC9]
 gi|229520162|ref|ZP_04409589.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae TM
           11079-80]
 gi|229524902|ref|ZP_04414307.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae bv.
           albensis VL426]
 gi|229530214|ref|ZP_04419603.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae
           12129(1)]
 gi|229606560|ref|YP_002877208.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae
           MJ-1236]
 gi|254226941|ref|ZP_04920507.1| ParA family protein [Vibrio cholerae V51]
 gi|254291139|ref|ZP_04961936.1| ParA family protein [Vibrio cholerae AM-19226]
 gi|254851564|ref|ZP_05240914.1| ParA family protein [Vibrio cholerae MO10]
 gi|255746817|ref|ZP_05420763.1| ATPase involved in chromosome partitioning [Vibrio cholera CIRS
           101]
 gi|258622943|ref|ZP_05717958.1| ParA family protein [Vibrio mimicus VM573]
 gi|258626068|ref|ZP_05720919.1| ParA family protein [Vibrio mimicus VM603]
 gi|262155897|ref|ZP_06029019.1| ATPase involved in chromosome partitioning [Vibrio cholerae INDRE
           91/1]
 gi|262166771|ref|ZP_06034508.1| ATPase involved in chromosome partitioning [Vibrio mimicus VM223]
 gi|262167089|ref|ZP_06034804.1| ATPase involved in chromosome partitioning [Vibrio cholerae RC27]
 gi|297581981|ref|ZP_06943901.1| ParA family protein [Vibrio cholerae RC385]
 gi|298501185|ref|ZP_07010984.1| ParA family protein [Vibrio cholerae MAK 757]
 gi|9657375|gb|AAF95912.1| ParA family protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121546615|gb|EAX56807.1| ParA family protein [Vibrio cholerae 2740-80]
 gi|124116197|gb|EAY35017.1| ParA family protein [Vibrio cholerae 1587]
 gi|124120864|gb|EAY39607.1| ParA family protein [Vibrio cholerae MZO-3]
 gi|125620546|gb|EAZ48914.1| ParA family protein [Vibrio cholerae V51]
 gi|126509344|gb|EAZ71938.1| ParA family protein [Vibrio cholerae NCTC 8457]
 gi|126520498|gb|EAZ77721.1| ParA family protein [Vibrio cholerae B33]
 gi|146316548|gb|ABQ21087.1| ParA family protein [Vibrio cholerae O395]
 gi|148874846|gb|EDL72981.1| ParA family protein [Vibrio cholerae 623-39]
 gi|150422984|gb|EDN14934.1| ParA family protein [Vibrio cholerae AM-19226]
 gi|227010773|gb|ACP06985.1| ParA family protein [Vibrio cholerae M66-2]
 gi|227011999|gb|ACP08209.1| ParA family protein [Vibrio cholerae O395]
 gi|229332347|gb|EEN97834.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae
           12129(1)]
 gi|229338483|gb|EEO03500.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae bv.
           albensis VL426]
 gi|229342756|gb|EEO07747.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae TM
           11079-80]
 gi|229346209|gb|EEO11181.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae RC9]
 gi|229347060|gb|EEO12022.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae TMA
           21]
 gi|229354352|gb|EEO19280.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae B33]
 gi|229354559|gb|EEO19481.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae BX
           330286]
 gi|229369215|gb|ACQ59638.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Vibrio cholerae
           MJ-1236]
 gi|254847269|gb|EET25683.1| ParA family protein [Vibrio cholerae MO10]
 gi|255735574|gb|EET90973.1| ATPase involved in chromosome partitioning [Vibrio cholera CIRS
           101]
 gi|258581594|gb|EEW06492.1| ParA family protein [Vibrio mimicus VM603]
 gi|258584726|gb|EEW09460.1| ParA family protein [Vibrio mimicus VM573]
 gi|262024475|gb|EEY43161.1| ATPase involved in chromosome partitioning [Vibrio cholerae RC27]
 gi|262026487|gb|EEY45155.1| ATPase involved in chromosome partitioning [Vibrio mimicus VM223]
 gi|262030349|gb|EEY48991.1| ATPase involved in chromosome partitioning [Vibrio cholerae INDRE
           91/1]
 gi|297533848|gb|EFH72689.1| ParA family protein [Vibrio cholerae RC385]
 gi|297540057|gb|EFH76119.1| ParA family protein [Vibrio cholerae MAK 757]
 gi|327485241|gb|AEA79648.1| Chromosome (plasmid) partitioning protein ParA / Sporulation
           initiation inhibitor protein Soj [Vibrio cholerae
           LMA3894-4]
          Length = 257

 Score =  264 bits (675), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL++DLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVVDLDPQGNATMASGVDKYQVDSTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   +Q++ +    +  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDAPFDQVVCRKTTGHYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNDNLKIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD + AG++A
Sbjct: 182 LRTMYDPRNRLANEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKQSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|317123168|ref|YP_004103171.1| chromosome segregation ATPase [Thermaerobacter marianensis DSM
           12885]
 gi|315593148|gb|ADU52444.1| chromosome segregation ATPase [Thermaerobacter marianensis DSM
           12885]
          Length = 260

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            R+I IANQKGGVGKTTT +NL   LAA+G  VL++D+DPQ N ++G G++      S Y
Sbjct: 2   GRVIAIANQKGGVGKTTTTVNLGACLAALGRKVLVVDIDPQANTTSGFGLDKGRVGRSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI+E+ + +++  TA+P L ++P+ ++L G E+ L G   R  RL +AL   +   + 
Sbjct: 62  DVLIDERGLREVIRSTALPGLWLVPANIELAGAELELVGMIGRETRLRRALE-SVRDGYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPPS  LLT+NAMAAAD +LVP+QCE++ALEGLSQLL T+  V+  +N  L + G
Sbjct: 121 FVLIDCPPSLGLLTLNAMAAADGLLVPIQCEYYALEGLSQLLNTLRAVQAHLNPGLVLDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QVV +V++    KV+ T+IPRNVR+SEAPS+G+P I+YD +  G++
Sbjct: 181 VVLTMFDGRTNLSIQVVEEVKRFFRDKVFRTIIPRNVRLSEAPSHGQPVILYDARSRGAE 240

Query: 246 AYLKLASELI 255
            Y++LA E++
Sbjct: 241 VYMELAKEVM 250


>gi|327399159|ref|YP_004340028.1| cobyrinic acid ac-diamide synthase [Hippea maritima DSM 10411]
 gi|327181788|gb|AEA33969.1| Cobyrinic acid ac-diamide synthase [Hippea maritima DSM 10411]
          Length = 248

 Score =  264 bits (674), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 127/250 (50%), Positives = 183/250 (73%), Gaps = 5/250 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I I NQKGGVGKTTTAINL  +LA  G+ VL+ID+DPQGNA++GLG+E   +    Y 
Sbjct: 2   RTIAITNQKGGVGKTTTAINLGASLAVFGKRVLIIDMDPQGNATSGLGVE---KDICVYH 58

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI ++ +  ++  T + NL I+PS + L+G E+ L  +K++  R+ K L ++   DF Y
Sbjct: 59  ALIGKRTLKSLITPTEMENLFIVPSNISLIGAEVELSHKKNKE-RILKEL-LKDIKDFDY 116

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS   LT+NA+ AA+S+LVP+QCE+FA+EGL+QLL T+  V++T N  L I+GI
Sbjct: 117 ILIDCPPSLGFLTINALVAANSVLVPVQCEYFAMEGLAQLLHTINLVKKTFNPTLKIEGI 176

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D RN+LS+QV  +++++    ++ T+IPRNVR+SEAPS+GK AI YD+KC GS++
Sbjct: 177 LLTMHDKRNNLSKQVEMELKRHFPKYIFKTLIPRNVRLSEAPSFGKSAITYDIKCPGSKS 236

Query: 247 YLKLASELIQ 256
           YL LA E+++
Sbjct: 237 YLSLAKEVLR 246


>gi|163751413|ref|ZP_02158638.1| ParA family protein [Shewanella benthica KT99]
 gi|161328716|gb|EDP99864.1| ParA family protein [Shewanella benthica KT99]
          Length = 262

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 182/257 (70%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++EK+ ++++ +       +I    D+   E+ L     R  RL  AL+  +  D+ Y
Sbjct: 63  LLVDEKSFDEVVYRNTSGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PIKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   +N  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKIGAMINPGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLANDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+I++    +E
Sbjct: 242 YLALAGEMIRRAEQHQE 258


>gi|313902794|ref|ZP_07836191.1| chromosome segregation ATPase [Thermaerobacter subterraneus DSM
           13965]
 gi|313466914|gb|EFR62431.1| chromosome segregation ATPase [Thermaerobacter subterraneus DSM
           13965]
          Length = 260

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            R+I IANQKGGVGKTTT +NL   LAA+G  VL++D+DPQ N ++G G++      S Y
Sbjct: 2   GRVIAIANQKGGVGKTTTTVNLGACLAALGRRVLVVDIDPQANTTSGFGLDKGRVGRSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI+++ + +++  TAIP L ++P+ ++L G E+ L G   R  RL +AL   +   + 
Sbjct: 62  DVLIDDRGLREVVRSTAIPGLFLVPANIELAGAELELVGMIGRETRLRRALE-GVKDGYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NAMAAAD +LVP+QCE++ALEGLSQLL T+  V+  +N  L + G
Sbjct: 121 FILIDCPPSLGLLTLNAMAAADGLLVPIQCEYYALEGLSQLLNTLRAVQAHLNPGLVLDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V++    KV+ T+IPRNVR+SEAPS+G+P I+YD +  G++
Sbjct: 181 VVLTMFDARTNLSIQVVEEVKRFFRDKVFRTIIPRNVRLSEAPSHGQPVILYDARSRGAE 240

Query: 246 AYLKLASELI 255
            Y++LA E++
Sbjct: 241 VYMELAKEVV 250


>gi|313893479|ref|ZP_07827049.1| sporulation initiation inhibitor protein Soj [Veillonella sp. oral
           taxon 158 str. F0412]
 gi|313441922|gb|EFR60344.1| sporulation initiation inhibitor protein Soj [Veillonella sp. oral
           taxon 158 str. F0412]
          Length = 255

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT++NLS  LA  G+ VLL+DLDPQGNAS+GLGIE  D +   +D
Sbjct: 3   KVIAITNQKGGVGKTTTSVNLSACLADAGKKVLLVDLDPQGNASSGLGIEKDDLELCVHD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+ + I  I+  T +  L + P+T+ L G E+ L     R   L KAL+  +  ++ +
Sbjct: 63  VLIDGEPIADIVQPTMLKKLFVAPATIQLAGAEVELVSVVSRETMLKKALA-PVRDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA  AADS+L+P+Q EF+ALEG+SQL++T+  V++T N  L+I+G+
Sbjct: 122 IIIDCPPSLGLLTLNAFTAADSVLIPIQSEFYALEGVSQLVKTITIVQQTSNKDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V+K  G KVY T+IPRNVR+SEAPSYG+P I+YD K  G+  
Sbjct: 182 LLTMFDGRTNLSIQVADEVKKFFGSKVYKTIIPRNVRLSEAPSYGEPIIVYDPKSKGADV 241

Query: 247 YLKLASELIQ 256
           Y KLA E+I+
Sbjct: 242 YTKLAKEVIK 251


>gi|91206165|ref|YP_538520.1| ATPase [Rickettsia bellii RML369-C]
 gi|157826533|ref|YP_001495597.1| ATPase [Rickettsia bellii OSU 85-389]
 gi|91069709|gb|ABE05431.1| ATPase [Rickettsia bellii RML369-C]
 gi|157801837|gb|ABV78560.1| ATPase [Rickettsia bellii OSU 85-389]
          Length = 257

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 176/249 (70%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I++ NQKGGV KTTT +NL+TALAA+ + VL+IDLDPQGN+STG G+    RK + Y 
Sbjct: 4   KVISVVNQKGGVAKTTTTVNLATALAAMDKKVLVIDLDPQGNSSTGFGVSQQQRKNTIYQ 63

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L     +   +I T IPNL II S  +L   E+ L   ++R + L K L   +   + Y
Sbjct: 64  ALTNIIKLKDTIISTDIPNLEIITSNTNLSAAELDLIKLEEREYILMKLLE-GIKVLYDY 122

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ A D +L+P+QC+F++LEGLS LL+TVE V + +N  + I GI
Sbjct: 123 IIIDCPPSLNLLTINALVAGDEVLIPMQCDFYSLEGLSHLLKTVEIVEKRLNPKIKITGI 182

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L++QV  DVR  LG  V+ TVIPRN+++SEAPSYGKPAIIYD KCAG+ A
Sbjct: 183 LFTMYDRRNRLTEQVEEDVRSCLGELVFKTVIPRNIKLSEAPSYGKPAIIYDYKCAGAVA 242

Query: 247 YLKLASELI 255
           Y++L  E++
Sbjct: 243 YMELTKEIL 251


>gi|157377625|ref|YP_001476225.1| cobyrinic acid a,c-diamide synthase [Shewanella sediminis HAW-EB3]
 gi|157319999|gb|ABV39097.1| cobyrinic acid a,c-diamide synthase [Shewanella sediminis HAW-EB3]
          Length = 262

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 184/257 (71%), Gaps = 2/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++EK+ ++++ +       +I    D+   E+ L     R  RL  AL+  +  D+ +
Sbjct: 63  LLVDEKSFDEVVYKDTTGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PIKDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADSILVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSILVPMQCEYYALEGLTALMDTISKLGSMVNPGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQ-ERHRK 262
           YL LA E+I++ E+H +
Sbjct: 242 YLALAGEIIRRAEQHEQ 258


>gi|156972766|ref|YP_001443673.1| chromosome partitioning ATPase [Vibrio harveyi ATCC BAA-1116]
 gi|156524360|gb|ABU69446.1| hypothetical protein VIBHAR_00431 [Vibrio harveyi ATCC BAA-1116]
          Length = 257

 Score =  263 bits (673), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   +Q++         +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDTPFDQVVCTETTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKHSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|295402131|ref|ZP_06812090.1| Cobyrinic acid ac-diamide synthase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312112748|ref|YP_003991064.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. Y4.1MC1]
 gi|294975814|gb|EFG51433.1| Cobyrinic acid ac-diamide synthase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311217849|gb|ADP76453.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. Y4.1MC1]
          Length = 253

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +++ IANQKGGVGKTTTA+NL+  LA IG+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   GKVVAIANQKGGVGKTTTAVNLAACLAHIGKKVLLVDVDPQGNATSGIGIEKGDIDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+ +     ++  T I NL IIP+T+ L G E+ L     R  RL  AL   L   + 
Sbjct: 62  NVLVGDVKAKDVIRPTNIENLHIIPATIQLAGAEIELVSVISREIRLKNALD-PLREAYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA S+L+P+QCE++ALEGLSQLL T+  V++ +N+ L ++G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAASSVLIPVQCEYYALEGLSQLLNTIRLVQKHLNNELRLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY+T+IPRNVR+SEAPS+GKP I+YD+K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFREKVYSTIIPRNVRLSEAPSHGKPIIVYDIKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++++
Sbjct: 241 VYLELAKEVLER 252


>gi|229000269|ref|ZP_04159838.1| Chromosome segregation ATPase [Bacillus mycoides Rock3-17]
 gi|229007793|ref|ZP_04165379.1| Chromosome segregation ATPase [Bacillus mycoides Rock1-4]
 gi|228753470|gb|EEM02922.1| Chromosome segregation ATPase [Bacillus mycoides Rock1-4]
 gi|228759601|gb|EEM08578.1| Chromosome segregation ATPase [Bacillus mycoides Rock3-17]
          Length = 253

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLLID+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLIDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   + +++ 
Sbjct: 62  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PIRNEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|228994199|ref|ZP_04154099.1| Chromosome segregation ATPase [Bacillus pseudomycoides DSM 12442]
 gi|228765651|gb|EEM14305.1| Chromosome segregation ATPase [Bacillus pseudomycoides DSM 12442]
          Length = 253

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLLID+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLIDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   + +++ 
Sbjct: 62  NVLVEDTDVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PIRNEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|294501983|ref|YP_003565683.1| sporulation initiation inhibitor protein [Bacillus megaterium QM
           B1551]
 gi|294351920|gb|ADE72249.1| sporulation initiation inhibitor protein [Bacillus megaterium QM
           B1551]
          Length = 260

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ +ANQKGGVGKTTTA+NL   LA  G+ VLL+D DPQGNA++G+GI+  D     Y+
Sbjct: 3   KIVAVANQKGGVGKTTTAVNLGACLAEQGKKVLLVDGDPQGNATSGVGIDKADVDECIYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++E+     ++  TA+ NLSIIP+T+ L G E+ L     R  RL +AL   +   F Y
Sbjct: 63  VVVEDMEAKNVVRSTAVENLSIIPATIQLAGAEIELVSTISREVRLKRALET-VKDHFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G+
Sbjct: 122 VIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNNQLRIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV ++V+K    +VY T+IPRNVR+SEAPS+G+P I+YD +  G+  
Sbjct: 182 LLTMLDARTNLGLQVTAEVKKYFQDRVYQTIIPRNVRLSEAPSHGEPIILYDARSRGAAV 241

Query: 247 YLKLASELIQQ-ERHRK 262
           Y +LA E+I   ER R+
Sbjct: 242 YTELAKEVIYNGERIRE 258


>gi|332800538|ref|YP_004462037.1| cobyrinic acid ac-diamide synthase [Tepidanaerobacter sp. Re1]
 gi|332698273|gb|AEE92730.1| Cobyrinic acid ac-diamide synthase [Tepidanaerobacter sp. Re1]
          Length = 258

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I IANQKGGVGKTTT++NL+  L  +G+ VLL+D+DPQGN+++G+GI+  +   + Y
Sbjct: 7   ARVIAIANQKGGVGKTTTSVNLAACLGVLGQKVLLVDIDPQGNSTSGIGIDKMNNDKTIY 66

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI E+ I    ++T   NL ++PS + L G E+ L     R ++L  A+   +  D+ 
Sbjct: 67  NVLINEEPIVNNTVKTDYENLYLLPSNIQLAGAEIELVPAISREYKLKNAIE-DIKGDYD 125

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AAD++LVP+QCE++ALEGL QL+ T+  V++ +N +L+++G
Sbjct: 126 FIIIDCPPSLGLLTLNALTAADTVLVPIQCEYYALEGLGQLMNTISLVQKHLNKSLEVEG 185

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K    KVY+T+IPRNVR+SEAPS+GKP I YD K  GS+
Sbjct: 186 VLLTMFDARTNLSIQVVDEVKKYFKNKVYSTIIPRNVRLSEAPSHGKPIINYDSKSRGSE 245

Query: 246 AYLKLASELIQQE 258
            Y+ LA E++  E
Sbjct: 246 VYMDLAKEVLDIE 258


>gi|138897063|ref|YP_001127516.1| forespore chromosome partitioning protein [Geobacillus
           thermodenitrificans NG80-2]
 gi|196249884|ref|ZP_03148580.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. G11MC16]
 gi|134268576|gb|ABO68771.1| Centromere-like function involved in forespore chromosome partition
           [Geobacillus thermodenitrificans NG80-2]
 gi|196210760|gb|EDY05523.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. G11MC16]
          Length = 253

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I IANQKGGVGKTTTA+NLS  LA +G+ VLL+D+DPQGNA++G+GIE  D     Y
Sbjct: 2   GKVIAIANQKGGVGKTTTAVNLSACLAYLGKKVLLVDVDPQGNATSGIGIEKGDVDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +++I +     ++  T I NL +IP+T+ L G E+ L     R  RL  AL   L + + 
Sbjct: 62  NVIIGDMKAKDVIRPTNIENLYVIPATIQLAGAEIELVSVISREIRLKNALD-PLKTVYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AAD++L+P+QCE++ALEGLSQLL T+  V+R +N  L ++G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAADAVLIPVQCEYYALEGLSQLLNTIRLVQRHLNYDLRLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD+K  G++
Sbjct: 181 VLLTMLDARTNLGLQVIQEVKKYFREKVYETIIPRNVRLSEAPSHGKPIILYDVKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++++
Sbjct: 241 VYLELAKEVLER 252


>gi|115374117|ref|ZP_01461405.1| soj protein [Stigmatella aurantiaca DW4/3-1]
 gi|310825565|ref|YP_003957923.1| ParA family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115368893|gb|EAU67840.1| soj protein [Stigmatella aurantiaca DW4/3-1]
 gi|309398637|gb|ADO76096.1| ParA family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 297

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/256 (48%), Positives = 183/256 (71%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII I+NQKGGVGKTTTAINL+ +LA+     LL+D+DPQGNA +GLG++    + + Y
Sbjct: 36  GRIICISNQKGGVGKTTTAINLAASLASAERRTLLVDMDPQGNAGSGLGLKREMLQGTVY 95

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D ++  + + ++L  T +  L ++P+T DL G E+ L  ++ R FRL +AL   L +D+ 
Sbjct: 96  DAILGGRPMRELLHPTELRFLQVVPATPDLTGAEVELVNQERREFRLREALR-PLAADYD 154

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+L+PLQCE++ALEGLSQL  TV+ V++ +N  L ++G
Sbjct: 155 YILIDCPPSLGLLTLNALVAADSVLIPLQCEYYALEGLSQLTHTVDLVQQGLNPGLKMEG 214

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFDSR +++ QVV + R     +V+  V+PRNVR++E PS+GKP I+YD+K  G +
Sbjct: 215 ILLTMFDSRANIANQVVEEARGYFKDQVFTAVVPRNVRLAECPSFGKPIILYDIKSKGCE 274

Query: 246 AYLKLASELIQQERHR 261
           +YL L  E++ +E H 
Sbjct: 275 SYLALGREIMNREGHH 290


>gi|254230611|ref|ZP_04923970.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Vibrio sp.
           Ex25]
 gi|262392795|ref|YP_003284649.1| ParA family protein [Vibrio sp. Ex25]
 gi|269965288|ref|ZP_06179409.1| ParA family protein [Vibrio alginolyticus 40B]
 gi|151936871|gb|EDN55770.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative [Vibrio sp.
           Ex25]
 gi|262336389|gb|ACY50184.1| ParA family protein [Vibrio sp. Ex25]
 gi|269830089|gb|EEZ84317.1| ParA family protein [Vibrio alginolyticus 40B]
          Length = 257

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   +Q++         +I +  D+   E+ L     R  RL  ALS  +  ++ +
Sbjct: 63  LLVEDTPFDQVVCTQTTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALS-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|312882252|ref|ZP_07741998.1| ParA family protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370096|gb|EFP97602.1| ParA family protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 257

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQIDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   ++++ +    N  +I +  D+   E+ L     R  RL +ALS  + + + +
Sbjct: 63  LLVEDVPFDEVVCRKTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKQALS-DVRNYYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           +F+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 VFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|118480507|ref|YP_897658.1| chromosome segregation ATPase [Bacillus thuringiensis str. Al
           Hakam]
 gi|118419732|gb|ABK88151.1| chromosome segregation ATPase [Bacillus thuringiensis str. Al
           Hakam]
          Length = 287

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 36  GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 95

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   + +++ 
Sbjct: 96  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRNEYD 154

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 155 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 214

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 215 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 274

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 275 VYIDLAEEVI 284


>gi|78224603|ref|YP_386350.1| chromosome segregation ATPase [Geobacter metallireducens GS-15]
 gi|78195858|gb|ABB33625.1| chromosome segregation ATPase [Geobacter metallireducens GS-15]
          Length = 257

 Score =  263 bits (672), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 186/256 (72%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++ I IANQKGGVGKTTTA+NL+ +LAA  +  LL+D+DPQGNA +G+GI+      S Y
Sbjct: 2   AKKICIANQKGGVGKTTTAVNLAASLAAAEKRTLLVDMDPQGNAGSGVGIDKGSLTESVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D +I + +   ++++T +  L ++P+T DL G E+ L     R ++L +AL+  L   + 
Sbjct: 62  DAIINDADPATLIVRTDLACLDLLPATTDLAGAELELVSAMAREWKLKEALA-HLDDRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NAM AADS+L+PLQCE++A+EGLSQ+++T++ V++ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTVNAMTAADSVLIPLQCEYYAMEGLSQIIKTIKLVQKGLNPKLAIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +LS+QV  ++R + G   + TV+PRNVR+SEAPS+G+P I+YD+   G+ 
Sbjct: 181 ILLTMYDGRINLSRQVSEEIRTHFGSLAFQTVVPRNVRLSEAPSHGRPIILYDITSKGAV 240

Query: 246 AYLKLASELIQQERHR 261
            Y++LA EL+++E H 
Sbjct: 241 TYMELAKELMEREAHH 256


>gi|52145288|ref|YP_086745.1| sporulation initiation inhibitor [Bacillus cereus E33L]
 gi|51978757|gb|AAU20307.1| sporulation initiation inhibitor [Bacillus cereus E33L]
          Length = 253

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIQKTATKNLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|295707334|ref|YP_003600409.1| sporulation initiation inhibitor protein [Bacillus megaterium DSM
           319]
 gi|294804993|gb|ADF42059.1| sporulation initiation inhibitor protein [Bacillus megaterium DSM
           319]
          Length = 260

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 183/258 (70%), Gaps = 2/258 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +I+ +ANQKGGVGKTTTA+NL   LA  G+ VLL+D DPQGNA++G+GI+  D     Y
Sbjct: 2   GKIVAVANQKGGVGKTTTAVNLGACLAEQGKKVLLVDGDPQGNATSGVGIDKADVDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++++E+     ++  TA+ NLSIIP+T+ L G E+ L     R  RL +AL   +   F 
Sbjct: 62  NVIVEDMEAKNVVRSTAVGNLSIIPATIQLAGAEIELVSTISREVRLKRALET-VKDHFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L I+G
Sbjct: 121 YVIIDCPPSLGLLTLNALTAADSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNNQLRIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV ++V+K    +VY T+IPRNVR+SEAPS+G+P I+YD +  G+ 
Sbjct: 181 VLLTMLDARTNLGLQVTAEVKKYFQDRVYQTIIPRNVRLSEAPSHGEPIILYDARSRGAA 240

Query: 246 AYLKLASELIQQ-ERHRK 262
            Y +LA E+I   ER R+
Sbjct: 241 VYTELAKEVIYNGERIRE 258


>gi|229087967|ref|ZP_04220075.1| Chromosome segregation ATPase [Bacillus cereus Rock3-44]
 gi|228695352|gb|EEL48229.1| Chromosome segregation ATPase [Bacillus cereus Rock3-44]
          Length = 253

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLLID+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLIDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+  +  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   + +++ 
Sbjct: 62  NVLVEDAEVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PIRNEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|304318128|ref|YP_003853273.1| cobyrinic acid ac-diamide synthase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302779630|gb|ADL70189.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 259

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 185/252 (73%), Gaps = 2/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL  +L+A G+ VL +D+DPQ N ++G GI+      ++Y+
Sbjct: 3   KIIAIANQKGGVGKTTTTINLGYSLSASGKKVLCVDMDPQSNMTSGFGIDNSSLNCTTYN 62

Query: 67  LLIEEKNINQILIQ-TAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LIE +NI + LI    +  +SI+PS++ L G E+ L     R FRL  +L+  +  D+ 
Sbjct: 63  ILIEGRNIKEALITLNEMNGISIVPSSIQLAGAEIELVPMLSREFRLKNSLN-DVKDDYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+LVP+QCE++ALEGL+QL+ T+  +++ +N +L+I+G
Sbjct: 122 YILIDCPPSLGLLTINALTAADSVLVPIQCEYYALEGLTQLMNTINLIKKNINHSLEIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMF++R +LS QVV +V+K   GKVY T+IPRN+R+ EAPS+GKP  +YD    G++
Sbjct: 182 VVLTMFNARTNLSIQVVDEVKKYFKGKVYGTIIPRNIRLGEAPSFGKPISLYDPHSKGAE 241

Query: 246 AYLKLASELIQQ 257
           AY +LA E+I++
Sbjct: 242 AYEELAKEIIER 253


>gi|229829504|ref|ZP_04455573.1| hypothetical protein GCWU000342_01596 [Shuttleworthia satelles DSM
           14600]
 gi|229791935|gb|EEP28049.1| hypothetical protein GCWU000342_01596 [Shuttleworthia satelles DSM
           14600]
          Length = 256

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 184/252 (73%), Gaps = 2/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINL+  LA  G+ +LLID DPQGNA++GLGI+    + S Y+
Sbjct: 3   RIIAIANQKGGVGKTTTAINLAACLAEAGKKILLIDCDPQGNATSGLGIDKDHLENSIYE 62

Query: 67  LLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L++E  I Q +     + NL+++PS ++L G E+ L   +D+ + L   +   +  D+ 
Sbjct: 63  VLLDECGIRQAMQAVDGVENLTVLPSNVNLAGAEVELLEVEDKEYILSNTVD-YIRDDYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS N+LT+NAM  ADS+LVP+QCE++ALEG+SQL+ TVE V+  +N  L I G
Sbjct: 122 YILIDCPPSLNILTVNAMTTADSVLVPIQCEYYALEGISQLIHTVELVQERLNPDLTIDG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D+R +LS  VV+ VR+NL  KVYNT+IPRNVR++EAPS+G P  +YD + +G++
Sbjct: 182 VVFTMYDARTNLSADVVASVRENLNTKVYNTIIPRNVRLAEAPSHGLPIHLYDSRSSGAE 241

Query: 246 AYLKLASELIQQ 257
           +Y  LA E+I++
Sbjct: 242 SYRNLAREVIER 253


>gi|255283802|ref|ZP_05348357.1| sporulation initiation inhibitor protein Soj [Bryantella
           formatexigens DSM 14469]
 gi|255265685|gb|EET58890.1| sporulation initiation inhibitor protein Soj [Bryantella
           formatexigens DSM 14469]
          Length = 258

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 187/257 (72%), Gaps = 5/257 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTTAINLS  LA  G+ VL ID+DPQGN ++GLG++  + + ++Y+
Sbjct: 3   RVIVVANQKGGVGKTTTAINLSACLAEAGKKVLAIDMDPQGNMTSGLGVDKDEIEKTTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E  + + L ++ +  L ++ S +DL   E+ L GE+++ F L KAL   + + + +
Sbjct: 63  LLLGETEVKECLQKSVVEGLDLLASNIDLAAAEIELIGEEEKEFILQKALE-PVRNQYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS N+LT+N+M AAD++LVP+QCE++ALEGLSQL+ T+  V+  +N  L+++G+
Sbjct: 122 VIIDCPPSLNILTINSMCAADTVLVPIQCEYYALEGLSQLIHTINLVQERLNPNLEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRNVR++EAPS+G P  +YD K AG+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKSNLQQTIYKTIIPRNVRLAEAPSHGMPITLYDTKSAGAES 241

Query: 247 YLKLASELIQQERHRKE 263
           Y  LA E+I    HR E
Sbjct: 242 YRLLAEEVI----HRGE 254


>gi|65317461|ref|ZP_00390420.1| COG1192: ATPases involved in chromosome partitioning [Bacillus
           anthracis str. A2012]
 gi|196045433|ref|ZP_03112664.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           03BB108]
 gi|228918092|ref|ZP_04081620.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228930486|ref|ZP_04093486.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228936760|ref|ZP_04099551.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228949202|ref|ZP_04111470.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229094591|ref|ZP_04225658.1| Chromosome segregation ATPase [Bacillus cereus Rock3-42]
 gi|229124983|ref|ZP_04254157.1| Chromosome segregation ATPase [Bacillus cereus 95/8201]
 gi|229187709|ref|ZP_04314845.1| Chromosome segregation ATPase [Bacillus cereus BGSC 6E1]
 gi|196023640|gb|EDX62316.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           03BB108]
 gi|228595777|gb|EEK53461.1| Chromosome segregation ATPase [Bacillus cereus BGSC 6E1]
 gi|228658484|gb|EEL14150.1| Chromosome segregation ATPase [Bacillus cereus 95/8201]
 gi|228688838|gb|EEL42669.1| Chromosome segregation ATPase [Bacillus cereus Rock3-42]
 gi|228810485|gb|EEM56838.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228822969|gb|EEM68810.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228829205|gb|EEM74842.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228841572|gb|EEM86688.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 287

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 36  GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 95

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 96  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 154

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 155 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 214

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 215 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 274

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 275 VYIDLAEEVI 284


>gi|152977679|ref|YP_001377196.1| cobyrinic acid ac-diamide synthase [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152026431|gb|ABS24201.1| Cobyrinic acid ac-diamide synthase [Bacillus cytotoxicus NVH
           391-98]
          Length = 253

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQMGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+  + +++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   + +++ 
Sbjct: 62  NVLVEDTAVQEVIKKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRTEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YVIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|260774533|ref|ZP_05883446.1| ATPase involved in chromosome partitioning [Vibrio metschnikovii
           CIP 69.14]
 gi|260610439|gb|EEX35645.1| ATPase involved in chromosome partitioning [Vibrio metschnikovii
           CIP 69.14]
          Length = 257

 Score =  263 bits (671), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL++DLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVVDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE    Q++ +       +I +  D+   E+ L     R  RL  AL++ +  ++ +
Sbjct: 63  LLVEEAPFEQVVCRKTSGYYDLIAANGDVTAAEIKLMEVFAREVRLKNALAL-VRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AGS+A
Sbjct: 182 LRTMYDPRNRLANEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKHSAGSKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|75761486|ref|ZP_00741450.1| Chromosome partitioning protein parA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228905424|ref|ZP_04069379.1| Chromosome segregation ATPase [Bacillus thuringiensis IBL 4222]
 gi|228911319|ref|ZP_04075123.1| Chromosome segregation ATPase [Bacillus thuringiensis IBL 200]
 gi|228988708|ref|ZP_04148793.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229072945|ref|ZP_04206141.1| Chromosome segregation ATPase [Bacillus cereus F65185]
 gi|229130726|ref|ZP_04259679.1| Chromosome segregation ATPase [Bacillus cereus BDRD-Cer4]
 gi|229148030|ref|ZP_04276369.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST24]
 gi|229199696|ref|ZP_04326339.1| Chromosome segregation ATPase [Bacillus cereus m1293]
 gi|74491025|gb|EAO54277.1| Chromosome partitioning protein parA [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|228583791|gb|EEK41966.1| Chromosome segregation ATPase [Bacillus cereus m1293]
 gi|228635455|gb|EEK91946.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST24]
 gi|228652743|gb|EEL08628.1| Chromosome segregation ATPase [Bacillus cereus BDRD-Cer4]
 gi|228710191|gb|EEL62169.1| Chromosome segregation ATPase [Bacillus cereus F65185]
 gi|228771020|gb|EEM19501.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228848337|gb|EEM93187.1| Chromosome segregation ATPase [Bacillus thuringiensis IBL 200]
 gi|228854244|gb|EEM98947.1| Chromosome segregation ATPase [Bacillus thuringiensis IBL 4222]
          Length = 259

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 8   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 67

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 68  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 126

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 127 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 186

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 187 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 246

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 247 VYIDLAEEVI 256


>gi|30023504|ref|NP_835135.1| sporulation initiation inhibitor protein soj [Bacillus cereus ATCC
           14579]
 gi|30265498|ref|NP_847875.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. Ames]
 gi|42784676|ref|NP_981923.1| sporulation initiation inhibitor protein Soj [Bacillus cereus ATCC
           10987]
 gi|47531066|ref|YP_022415.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|47568679|ref|ZP_00239376.1| ATPase, ParA family [Bacillus cereus G9241]
 gi|49188317|ref|YP_031570.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. Sterne]
 gi|49481157|ref|YP_039470.1| sporulation initiation inhibitor [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|165873029|ref|ZP_02217650.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0488]
 gi|167635048|ref|ZP_02393365.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0442]
 gi|167641742|ref|ZP_02399985.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0193]
 gi|170689476|ref|ZP_02880666.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0465]
 gi|170707524|ref|ZP_02897977.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0389]
 gi|177655267|ref|ZP_02936821.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0174]
 gi|190569284|ref|ZP_03022178.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036112|ref|ZP_03103512.1| sporulation initiation inhibitor protein Soj [Bacillus cereus W]
 gi|196041958|ref|ZP_03109245.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           NVH0597-99]
 gi|206970019|ref|ZP_03230972.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH1134]
 gi|206975817|ref|ZP_03236728.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           H3081.97]
 gi|217962972|ref|YP_002341550.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH187]
 gi|218235603|ref|YP_002370255.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           B4264]
 gi|218900621|ref|YP_002449032.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           G9842]
 gi|218906672|ref|YP_002454506.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH820]
 gi|222098957|ref|YP_002533015.1| sporulation initiation inhibitor [Bacillus cereus Q1]
 gi|227818249|ref|YP_002818258.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. CDC 684]
 gi|228924225|ref|ZP_04087496.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228942629|ref|ZP_04105161.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228955730|ref|ZP_04117725.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228961744|ref|ZP_04123347.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228975559|ref|ZP_04136111.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228982195|ref|ZP_04142484.1| Chromosome segregation ATPase [Bacillus thuringiensis Bt407]
 gi|229051149|ref|ZP_04194693.1| Chromosome segregation ATPase [Bacillus cereus AH676]
 gi|229112893|ref|ZP_04242424.1| Chromosome segregation ATPase [Bacillus cereus Rock1-15]
 gi|229142229|ref|ZP_04270753.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST26]
 gi|229153639|ref|ZP_04281815.1| Chromosome segregation ATPase [Bacillus cereus m1550]
 gi|229159040|ref|ZP_04287096.1| Chromosome segregation ATPase [Bacillus cereus ATCC 4342]
 gi|229193731|ref|ZP_04320672.1| Chromosome segregation ATPase [Bacillus cereus ATCC 10876]
 gi|229604192|ref|YP_002869689.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0248]
 gi|254687079|ref|ZP_05150937.1| chromosome segregation ATPase [Bacillus anthracis str. CNEVA-9066]
 gi|254724138|ref|ZP_05185923.1| chromosome segregation ATPase [Bacillus anthracis str. A1055]
 gi|254735155|ref|ZP_05192865.1| chromosome segregation ATPase [Bacillus anthracis str. Western
           North America USA6153]
 gi|254742136|ref|ZP_05199823.1| chromosome segregation ATPase [Bacillus anthracis str. Kruger B]
 gi|254755954|ref|ZP_05207986.1| chromosome segregation ATPase [Bacillus anthracis str. Vollum]
 gi|254761366|ref|ZP_05213388.1| chromosome segregation ATPase [Bacillus anthracis str. Australia
           94]
 gi|296505908|ref|YP_003667608.1| sporulation initiation inhibitor protein soj [Bacillus
           thuringiensis BMB171]
 gi|300118818|ref|ZP_07056538.1| chromosome segregation ATPase [Bacillus cereus SJ1]
 gi|29899065|gb|AAP12336.1| Sporulation initiation inhibitor protein soj [Bacillus cereus ATCC
           14579]
 gi|30260176|gb|AAP29361.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. Ames]
 gi|42740608|gb|AAS44531.1| sporulation initiation inhibitor protein Soj [Bacillus cereus ATCC
           10987]
 gi|47506214|gb|AAT34890.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|47554667|gb|EAL13021.1| ATPase, ParA family [Bacillus cereus G9241]
 gi|49182244|gb|AAT57620.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. Sterne]
 gi|49332713|gb|AAT63359.1| sporulation initiation inhibitor [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|164711241|gb|EDR16797.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0488]
 gi|167510296|gb|EDR85699.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0193]
 gi|167529522|gb|EDR92272.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0442]
 gi|170127520|gb|EDS96394.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0389]
 gi|170666578|gb|EDT17351.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0465]
 gi|172080194|gb|EDT65286.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0174]
 gi|190559591|gb|EDV13582.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991279|gb|EDX55247.1| sporulation initiation inhibitor protein Soj [Bacillus cereus W]
 gi|196027213|gb|EDX65833.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           NVH0597-99]
 gi|206734596|gb|EDZ51765.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH1134]
 gi|206745911|gb|EDZ57307.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           H3081.97]
 gi|217063371|gb|ACJ77621.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH187]
 gi|218163560|gb|ACK63552.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           B4264]
 gi|218535720|gb|ACK88118.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           AH820]
 gi|218544607|gb|ACK97001.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           G9842]
 gi|221243016|gb|ACM15726.1| sporulation initiation inhibitor [Bacillus cereus Q1]
 gi|227007516|gb|ACP17259.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. CDC 684]
 gi|228589756|gb|EEK47634.1| Chromosome segregation ATPase [Bacillus cereus ATCC 10876]
 gi|228624459|gb|EEK81230.1| Chromosome segregation ATPase [Bacillus cereus ATCC 4342]
 gi|228629825|gb|EEK86478.1| Chromosome segregation ATPase [Bacillus cereus m1550]
 gi|228641247|gb|EEK97554.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST26]
 gi|228670572|gb|EEL25885.1| Chromosome segregation ATPase [Bacillus cereus Rock1-15]
 gi|228722212|gb|EEL73613.1| Chromosome segregation ATPase [Bacillus cereus AH676]
 gi|228777547|gb|EEM25825.1| Chromosome segregation ATPase [Bacillus thuringiensis Bt407]
 gi|228784169|gb|EEM32196.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228797938|gb|EEM44948.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228803958|gb|EEM50582.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228817055|gb|EEM63148.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228835443|gb|EEM80813.1| Chromosome segregation ATPase [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|229268600|gb|ACQ50237.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           str. A0248]
 gi|296326960|gb|ADH09888.1| sporulation initiation inhibitor protein soj [Bacillus
           thuringiensis BMB171]
 gi|298723786|gb|EFI64508.1| chromosome segregation ATPase [Bacillus cereus SJ1]
 gi|324329431|gb|ADY24691.1| chromosome segregation ATPase [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326943278|gb|AEA19174.1| sporulation initiation inhibitor [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 253

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|319648508|ref|ZP_08002724.1| chromosome partitioning protein transcriptional regulator [Bacillus
           sp. BT1B_CT2]
 gi|317389587|gb|EFV70398.1| chromosome partitioning protein transcriptional regulator [Bacillus
           sp. BT1B_CT2]
          Length = 259

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 182/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+G+E  D     YD
Sbjct: 9   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGIGVEKADVDQCVYD 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  ++  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ +
Sbjct: 69  ILVDDADVKDVIKTTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDF 127

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL +V  V++ +N+ L I G+
Sbjct: 128 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNSVRLVQKHLNTDLMIDGV 187

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 188 LLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAEV 247

Query: 247 YLKLASEL 254
           YL+LA E+
Sbjct: 248 YLELAKEV 255


>gi|225867461|ref|YP_002752839.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           03BB102]
 gi|229020705|ref|ZP_04177432.1| Chromosome segregation ATPase [Bacillus cereus AH1273]
 gi|229026921|ref|ZP_04183244.1| Chromosome segregation ATPase [Bacillus cereus AH1272]
 gi|229035138|ref|ZP_04189084.1| Chromosome segregation ATPase [Bacillus cereus AH1271]
 gi|229176156|ref|ZP_04303648.1| Chromosome segregation ATPase [Bacillus cereus MM3]
 gi|225790455|gb|ACO30672.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           03BB102]
 gi|228607315|gb|EEK64645.1| Chromosome segregation ATPase [Bacillus cereus MM3]
 gi|228728204|gb|EEL79234.1| Chromosome segregation ATPase [Bacillus cereus AH1271]
 gi|228734379|gb|EEL85050.1| Chromosome segregation ATPase [Bacillus cereus AH1272]
 gi|228740600|gb|EEL90871.1| Chromosome segregation ATPase [Bacillus cereus AH1273]
          Length = 253

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIRKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|269103811|ref|ZP_06156508.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163709|gb|EEZ42205.1| chromosome (plasmid) partitioning protein ParA/sporulation
           initiation inhibitor protein soj [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 265

 Score =  263 bits (671), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/255 (48%), Positives = 180/255 (70%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT +NL+ +LAA    VL+IDLDPQGNA+   G++ Y  + ++YD
Sbjct: 3   RIIAVANQKGGVGKTTTCVNLAASLAATQRKVLVIDLDPQGNATMASGVDKYQVEATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+    Q+ I        +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEQTPFEQVAITETTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALAT-VRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAM AADS+LVP+QCE+FALEGL+ L++T+ ++   VN+ L I+G+
Sbjct: 122 IFIDCPPALNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNADLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+G+PA+ YD   +G++A
Sbjct: 182 LRTMFDPRNRLANEVSDQLKKHFGDKVYRTVIPRNVRLAEAPSHGRPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQERHR 261
           YL LA E+I++E  +
Sbjct: 242 YLALAGEMIRREEQQ 256


>gi|229099907|ref|ZP_04230830.1| Chromosome segregation ATPase [Bacillus cereus Rock3-29]
 gi|229106074|ref|ZP_04236687.1| Chromosome segregation ATPase [Bacillus cereus Rock3-28]
 gi|229118970|ref|ZP_04248315.1| Chromosome segregation ATPase [Bacillus cereus Rock1-3]
 gi|228664495|gb|EEL19991.1| Chromosome segregation ATPase [Bacillus cereus Rock1-3]
 gi|228677340|gb|EEL31604.1| Chromosome segregation ATPase [Bacillus cereus Rock3-28]
 gi|228683522|gb|EEL37477.1| Chromosome segregation ATPase [Bacillus cereus Rock3-29]
          Length = 253

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIRKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKDLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|258517426|ref|YP_003193648.1| Cobyrinic acid ac-diamide synthase [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257781131|gb|ACV65025.1| Cobyrinic acid ac-diamide synthase [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 253

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 184/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I IANQKGGVGKTTTA+NLS+ L+ IG+ VLLID+DPQGNAS+G+GI   +  Y  YD
Sbjct: 3   RTIAIANQKGGVGKTTTAVNLSSWLSLIGKKVLLIDIDPQGNASSGVGIVKDNLDYCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI  K ++ +  +T I  L I+PST+DL G E+ +  +  R   L KA++ Q+   + Y
Sbjct: 63  VLINNKTVDDVKQKTIIDGLYILPSTVDLAGAEIEMVNKNSRENILKKAIN-QIKEKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ AADS+L+ +QCE++ALEGL QL+ TV+ V++++N  L ++G+
Sbjct: 122 IIIDCPPSLGLLTINSLTAADSLLITIQCEYYALEGLGQLMNTVKLVQQSLNPKLTLEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QVV +V+K    KVY  +IPRNVR+SEAPS+GKP ++YD +  G++ 
Sbjct: 182 LLTMFDGRTNLSIQVVDEVKKFFKNKVYKNIIPRNVRLSEAPSHGKPVMLYDPRSRGAEV 241

Query: 247 YLKLASELIQQE 258
           Y +LA E++  E
Sbjct: 242 YQELAKEVLGIE 253


>gi|226315522|ref|YP_002775418.1| sporulation initiation inhibitor protein [Brevibacillus brevis NBRC
           100599]
 gi|226098472|dbj|BAH46914.1| sporulation initiation inhibitor protein [Brevibacillus brevis NBRC
           100599]
          Length = 252

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/249 (50%), Positives = 179/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT++NLS  LAA+G+ VLL+D+DPQGNA++G+G+   D KY  YD
Sbjct: 3   KIIAVANQKGGVGKTTTSVNLSACLAALGKKVLLVDIDPQGNATSGIGVNKADVKYCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI + N     + T I  L IIP+T+ L G E+ L     R  RL KAL V +   + Y
Sbjct: 63  VLINDINPVDATLPTEIEGLMIIPATIQLAGAEIELVPTISREVRLKKALEV-VKDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  +LT+N++ A+DS+L+P+QCE++ALEGLSQLL T+  V++ +NS L I+G+
Sbjct: 122 VIIDCPPSLGILTVNSLTASDSVLIPIQCEYYALEGLSQLLNTIRLVQKHLNSQLAIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++ 
Sbjct: 182 VLTMLDARTNLGLQVIEEVKKYFQDKVYKTIIPRNVRLSEAPSHGQAIITYDPRSRGAEV 241

Query: 247 YLKLASELI 255
           Y  LA E++
Sbjct: 242 YTDLAKEVV 250


>gi|52788041|ref|YP_093870.1| hypothetical protein BLi04369 [Bacillus licheniformis ATCC 14580]
 gi|52350543|gb|AAU43177.1| Soj [Bacillus licheniformis ATCC 14580]
          Length = 253

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 182/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+G+E  D     YD
Sbjct: 3   KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGIGVEKADVDQCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  ++  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ +
Sbjct: 63  ILVDDADVKDVIKTTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL +V  V++ +N+ L I G+
Sbjct: 122 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNSVRLVQKHLNTDLMIDGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAEV 241

Query: 247 YLKLASEL 254
           YL+LA E+
Sbjct: 242 YLELAKEV 249


>gi|313904715|ref|ZP_07838089.1| Cobyrinic acid ac-diamide synthase [Eubacterium cellulosolvens 6]
 gi|313470508|gb|EFR65836.1| Cobyrinic acid ac-diamide synthase [Eubacterium cellulosolvens 6]
          Length = 271

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 184/262 (70%), Gaps = 7/262 (2%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E+K SRII +ANQKGGVGK+TTAINLS+ LA  G+ VL+ID+DPQGN ++GLGI+     
Sbjct: 8   EKKLSRIIAVANQKGGVGKSTTAINLSSCLAEQGKKVLVIDMDPQGNTTSGLGIDKVQLD 67

Query: 62  YSSYDLLIEEKNINQILIQ------TAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKA 115
            + Y+L I E  I   ++        AI    +IPS +DL G E+ L   +++ + L   
Sbjct: 68  NTVYELFIGECGIEDCMVHLKYKKAEAIKKFYLIPSHVDLAGAEVELVDVENKEYLLRDK 127

Query: 116 LSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRR 175
           ++ +    F YI +DCPPS NLLT+NAM  ADS+L+P+QCE++ALEGL+QLL T++ V+ 
Sbjct: 128 IA-EYRDRFDYIIIDCPPSLNLLTVNAMTTADSVLIPIQCEYYALEGLAQLLYTIQLVQE 186

Query: 176 TVNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAI 235
            +N  L I+G++ TMFDSR +LS QV+ DV++NL   ++ +VIPRNVR++EAPSYG P  
Sbjct: 187 RLNDTLSIEGVVFTMFDSRTNLSGQVMEDVKENLEAHIFKSVIPRNVRLAEAPSYGLPIN 246

Query: 236 IYDLKCAGSQAYLKLASELIQQ 257
           IY+ K  GS+AY KLA E+I++
Sbjct: 247 IYEKKSEGSKAYKKLAKEIIKK 268


>gi|269962681|ref|ZP_06177026.1| ParA family protein [Vibrio harveyi 1DA3]
 gi|269832604|gb|EEZ86718.1| ParA family protein [Vibrio harveyi 1DA3]
          Length = 257

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   +Q++         +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDTPFDQVVCTETTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|253581101|ref|ZP_04858361.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847637|gb|EES75607.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 255

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 184/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGK+TTAINLS  LA  G+ VL ID+DPQGN ++G G++    + + Y+
Sbjct: 3   RIIAVANQKGGVGKSTTAINLSACLAEKGKKVLAIDMDPQGNTTSGFGVDKNGIENTLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E  +   +++  + NL +IPS ++L G E+ L G  D+ F L K ++ +L   + Y
Sbjct: 63  LLLGEAEMKDTIVKDVVENLDLIPSNINLSGAEIELVGIDDKEFIL-KGITDKLRRKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDCPPS N+LT+NA+ AA S+LVP+QCE++ALEGLSQL+ T++ V+  +N  L ++G+
Sbjct: 122 IILDCPPSLNMLTINALTAATSVLVPIQCEYYALEGLSQLIHTIDLVKERLNKRLKMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRNVR++EAPSYG+P  IYD + AG+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLNQNIYKTIIPRNVRLAEAPSYGQPINIYDPRSAGAES 241

Query: 247 YLKLASELIQQE 258
           Y  LA E++ +E
Sbjct: 242 YRLLAEEVLNRE 253


>gi|52082642|ref|YP_081433.1| chromosome partitioning protein transcriptional regulator [Bacillus
           licheniformis ATCC 14580]
 gi|52005853|gb|AAU25795.1| chromosome partitioning protein transcriptional regulator [Bacillus
           licheniformis ATCC 14580]
          Length = 262

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 182/248 (73%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+G+E  D     YD
Sbjct: 12  KIIAITNQKGGVGKTTTSVNLGACLAYIGKRVLLVDIDPQGNATSGIGVEKADVDQCVYD 71

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++ ++  ++  T++ NL +IP+T+ L G E+ L     R  RL +AL   +  ++ +
Sbjct: 72  ILVDDADVKDVIKTTSVENLDVIPATIQLAGAEIELVPTISREVRLKRALE-SVKQNYDF 130

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+ A+DS+++P+QCE++ALEGLSQLL +V  V++ +N+ L I G+
Sbjct: 131 MIIDCPPSLGLLTINALTASDSVVIPVQCEYYALEGLSQLLNSVRLVQKHLNTDLMIDGV 190

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY TVIPRNVR+SEAPS+GKP I+YD +  G++ 
Sbjct: 191 LLTMLDARTNLGIQVIEEVKKYFRDKVYKTVIPRNVRLSEAPSHGKPIILYDPRSRGAEV 250

Query: 247 YLKLASEL 254
           YL+LA E+
Sbjct: 251 YLELAKEV 258


>gi|197302258|ref|ZP_03167317.1| hypothetical protein RUMLAC_00985 [Ruminococcus lactaris ATCC
           29176]
 gi|197298689|gb|EDY33230.1| hypothetical protein RUMLAC_00985 [Ruminococcus lactaris ATCC
           29176]
          Length = 278

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 185/254 (72%), Gaps = 1/254 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K  RII IANQKGGVGKTTTAINLS +LA++G+ VL ID+DPQGN S+GLG++  + + +
Sbjct: 23  KMGRIIAIANQKGGVGKTTTAINLSASLASLGKKVLAIDMDPQGNMSSGLGVDKNEVEKT 82

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            YDL+I    I + + +  I NL ++PS +DL   E+ L G  ++ + L   ++ ++   
Sbjct: 83  VYDLIIGNIGIEECIYEEVIENLDVLPSNIDLSAAEIELIGVDNKEYILRDEVN-KVKEK 141

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + +I +DCPP+ ++LT+NAM  +DS+LVP+QCE++ALEGLSQL+ T+E V+  +N  L+I
Sbjct: 142 YDFIIIDCPPALSMLTINAMTTSDSVLVPIQCEYYALEGLSQLIHTIELVQERLNPELEI 201

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++ TM+D+R +LS QVV +V+ NL   +Y T+IPRNVR++EAPSYG P  +YD K  G
Sbjct: 202 EGVVFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNVRLAEAPSYGMPINLYDPKSKG 261

Query: 244 SQAYLKLASELIQQ 257
           +++YL LA E+I +
Sbjct: 262 TESYLLLAEEVINK 275


>gi|310644867|ref|YP_003949626.1| atpase, para family protein [Paenibacillus polymyxa SC2]
 gi|309249818|gb|ADO59385.1| ATPase, ParA family protein [Paenibacillus polymyxa SC2]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II +ANQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAVANQKGGVGKTTTSVNLGAGLASLGKRVLLVDIDPQGNTTSGVGINKADVANCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E + ++ +I T +  L IIP+T+ L G E+ L     R  RL ++L + +  ++ 
Sbjct: 62  DVLINEVDPSEAIISTQVEGLDIIPATIQLAGAEIELVPTISRELRLKRSLQL-VKHNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N++L I+G
Sbjct: 121 YILIDCPPSLGILTLNSLTASDSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMFDARTNLGIQVIEEVKKYFQSKVYQTIIPRNVRLSEAPSHGQSIITYDPRSRGAE 240

Query: 246 AYLKLASELIQQE 258
            Y++LA E++  E
Sbjct: 241 VYIELAKEVVSYE 253


>gi|301056954|ref|YP_003795165.1| sporulation initiation inhibitor protein Soj [Bacillus anthracis
           CI]
 gi|300379123|gb|ADK08027.1| sporulation initiation inhibitor protein Soj [Bacillus cereus
           biovar anthracis str. CI]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|229826002|ref|ZP_04452071.1| hypothetical protein GCWU000182_01366 [Abiotrophia defectiva ATCC
           49176]
 gi|229789744|gb|EEP25858.1| hypothetical protein GCWU000182_01366 [Abiotrophia defectiva ATCC
           49176]
          Length = 272

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/255 (48%), Positives = 183/255 (71%), Gaps = 1/255 (0%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E+   R+I +ANQKGGVGKTTT INLS  LA  G+ VL+ID+DPQGN S+GLG++  + +
Sbjct: 15  EDDMGRVIAVANQKGGVGKTTTVINLSACLAEKGKKVLVIDIDPQGNTSSGLGVDKNNAE 74

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            + Y+LL+ E  +   +++     LSI+P+ ++L G E+ L G  D+ + L K +   + 
Sbjct: 75  NTVYELLLGECELKDCIVENVYDGLSIVPANVNLAGAEIELIGIPDQHYILKKHIET-MR 133

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           +D+ +I +DCPPS N LT+NAM+AADS+LVP+QCE++ALEGLSQL+ T+E V+  +N  L
Sbjct: 134 ADYDFIIIDCPPSLNTLTVNAMSAADSVLVPIQCEYYALEGLSQLIHTIELVKARMNEGL 193

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++ TM+D+R +LS QVV +V+  L   +Y T+IPRNVR++E+PS+G P  IYD K 
Sbjct: 194 YIEGVVFTMYDARTNLSLQVVENVKDTLKQNIYKTIIPRNVRLAESPSHGVPINIYDPKS 253

Query: 242 AGSQAYLKLASELIQ 256
           AG++ Y  LA E+I+
Sbjct: 254 AGAEGYRALADEVIE 268


>gi|149190483|ref|ZP_01868754.1| ParA family protein [Vibrio shilonii AK1]
 gi|148835737|gb|EDL52703.1| ParA family protein [Vibrio shilonii AK1]
          Length = 257

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT +NL+ ++AA    +L+IDLDPQGNA+   G++ Y  + ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCVNLAASMAATKRKILVIDLDPQGNATMASGVDKYQVETTAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++E    Q++ Q       +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVDELPFEQVVCQDTSGQFDLIAANGDVTAAEIKLMEVFAREVRLKHALA-PIRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLANEVSEQLKKHFGDKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|163803606|ref|ZP_02197472.1| F0F1 ATP synthase subunit I [Vibrio sp. AND4]
 gi|159172600|gb|EDP57458.1| F0F1 ATP synthase subunit I [Vibrio sp. AND4]
          Length = 257

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++YD
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYMVDATAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   +Q++         +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDTPFDQVVCTETTGKYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-PVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGSKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|163943160|ref|YP_001648044.1| cobyrinic acid ac-diamide synthase [Bacillus weihenstephanensis
           KBAB4]
 gi|229014646|ref|ZP_04171760.1| Chromosome segregation ATPase [Bacillus mycoides DSM 2048]
 gi|229065139|ref|ZP_04200432.1| Chromosome segregation ATPase [Bacillus cereus AH603]
 gi|229136305|ref|ZP_04265052.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST196]
 gi|229170183|ref|ZP_04297869.1| Chromosome segregation ATPase [Bacillus cereus AH621]
 gi|163865357|gb|ABY46416.1| Cobyrinic acid ac-diamide synthase [Bacillus weihenstephanensis
           KBAB4]
 gi|228613284|gb|EEK70423.1| Chromosome segregation ATPase [Bacillus cereus AH621]
 gi|228647177|gb|EEL03265.1| Chromosome segregation ATPase [Bacillus cereus BDRD-ST196]
 gi|228716168|gb|EEL67887.1| Chromosome segregation ATPase [Bacillus cereus AH603]
 gi|228746657|gb|EEL96546.1| Chromosome segregation ATPase [Bacillus mycoides DSM 2048]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++   + +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGAIRKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PIRDEYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            YL LA E+I
Sbjct: 241 VYLDLAEEVI 250


>gi|134301150|ref|YP_001114646.1| cobyrinic acid a,c-diamide synthase [Desulfotomaculum reducens
           MI-1]
 gi|134053850|gb|ABO51821.1| chromosome segregation ATPase [Desulfotomaculum reducens MI-1]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 184/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II  ANQKGGV KTTTA+NL  +L+ +G+ VLL+D+DPQGNAS+GLGI+    +   YD
Sbjct: 3   KIIATANQKGGVAKTTTAVNLGASLSLMGQPVLLVDIDPQGNASSGLGIDKTRLERCVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI +    + +I T I  L ++PST+ L G E+ +     R   L +ALS  L   ++Y
Sbjct: 63  VLINDMTAKEAIIHTGIKYLDVLPSTIQLAGAEVEMVSLMAREQILKRALS-PLKEKYNY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+AA+DS+L+P+QCEF+ALEG+ QL+ TV+ V++ +N +L+I+G+
Sbjct: 122 IIIDCPPSLGLLTLNALAASDSLLIPIQCEFYALEGVGQLMNTVQLVKKHLNPSLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +LS QVV +V+K  G KV+  +IPRNVR+SEAPS+G P ++YD K  GS+A
Sbjct: 182 LLTMFDARLNLSIQVVDEVKKVFGTKVFQNIIPRNVRLSEAPSHGMPVVLYDPKSKGSEA 241

Query: 247 YLKLASELIQQE 258
           Y +LA E++  E
Sbjct: 242 YQELAKEVMGIE 253


>gi|238917969|ref|YP_002931486.1| chromosome partitioning protein [Eubacterium eligens ATCC 27750]
 gi|238873329|gb|ACR73039.1| chromosome partitioning protein [Eubacterium eligens ATCC 27750]
          Length = 260

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 187/253 (73%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS  LA  G+ VL+ID+DPQGN ++G G+   + + + Y+
Sbjct: 9   RIIAIANQKGGVGKTTTAINLSACLAEAGQKVLVIDIDPQGNTTSGFGLSKTEIEKTVYE 68

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++ E +I + +++  I NL I+PS ++L G E+ L   ++R + L +++S ++   + Y
Sbjct: 69  VILRECDIKEAIVEDVIENLDILPSNVNLAGAEIDLIDVENREYTLKESIS-EIREKYEY 127

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDCPPS ++LT+NAM AAD++LVP+QCE++ALEGL+QL+ T+  V++ +N  L+++G+
Sbjct: 128 IILDCPPSLSMLTVNAMTAADTVLVPIQCEYYALEGLTQLIHTINLVKKKLNPELELEGV 187

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+DSR +LS QVV +V+ NL   +Y T+IPRN+R++EAPS+G P  +YD K  G+++
Sbjct: 188 VFTMYDSRTNLSLQVVENVKDNLKQNIYKTIIPRNIRLAEAPSHGLPINLYDTKSTGAES 247

Query: 247 YLKLASELIQQER 259
           Y  LA E++ +E 
Sbjct: 248 YRLLAEEVMGREE 260


>gi|330831714|ref|YP_004394666.1| F0F1 ATP synthase subunit I [Aeromonas veronii B565]
 gi|328806850|gb|AEB52049.1| F0F1 ATP synthase subunit I [Aeromonas veronii B565]
          Length = 267

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 121/258 (46%), Positives = 183/258 (70%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ ++AA    VL+IDLDPQGNA+ G G++ YD + ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYDVERTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIE+  I++++I        +I +  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLIEDAPISEVIIPETTGGYHLIAANADVTAAEIRLMEFFAREIRLRNALA-SVRDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           +F+DCPPS N+LT+NAMAAADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 VFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPDLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+  V   ++++ G KVY T+IPRNVR++EAPS+G PA+ YD    G++A
Sbjct: 182 LRTMFDHRNRLANDVSDQLKQHFGDKVYRTIIPRNVRLAEAPSFGAPAMHYDKSSVGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+++++   ++A
Sbjct: 242 YLALAGEILRRQEQERQA 259


>gi|323496915|ref|ZP_08101943.1| ParA family protein [Vibrio sinaloensis DSM 21326]
 gi|323317989|gb|EGA70972.1| ParA family protein [Vibrio sinaloensis DSM 21326]
          Length = 257

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+    +++      N  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDVPFAEVVCHNTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKHALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|229181726|ref|ZP_04309049.1| Chromosome segregation ATPase [Bacillus cereus 172560W]
 gi|228601759|gb|EEK59257.1| Chromosome segregation ATPase [Bacillus cereus 172560W]
          Length = 253

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA +G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQVGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +   + 
Sbjct: 62  NVLVEDADVQGVIQKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDKYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|146297750|ref|YP_001181521.1| cobyrinic acid a,c-diamide synthase [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145411326|gb|ABP68330.1| chromosome segregation ATPase [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 256

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R++ + NQKGGVGKTTT +NLS A++  G+ VL +D DPQGN ++G GI+    + + Y
Sbjct: 2   ARVVAVVNQKGGVGKTTTCVNLSAAISKKGKKVLAVDCDPQGNLTSGFGIDKKSLEKTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   +I +++I+    NL I+PS ++L G E+ L     R +RL  A+   + S++ 
Sbjct: 62  DVLIGSADIKEVIIKDKFENLDILPSNVNLAGSEIELVSVIAREYRLKSAIE-SVKSEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+AA+DS+++P+QCE++ALEGLSQL  T+  VR+ +N  L+I G
Sbjct: 121 YIFIDCPPSLGLLTLNALAASDSVVIPIQCEYYALEGLSQLSSTINLVRKHLNKHLEIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS +VV +V+K  G KV+ ++IPRNVR+SEAPS+G P I YD    G++
Sbjct: 181 VVLTMFDSRTNLSLEVVEEVKKYFGEKVFLSIIPRNVRLSEAPSFGLPGIFYDPDSKGAR 240

Query: 246 AYLKLASELIQQ 257
           AY++LA E + +
Sbjct: 241 AYIELADEYLNK 252


>gi|323493000|ref|ZP_08098136.1| ParA family protein [Vibrio brasiliensis LMG 20546]
 gi|323312736|gb|EGA65864.1| ParA family protein [Vibrio brasiliensis LMG 20546]
          Length = 257

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   ++++ +    N  +I +  D+   E+ L     R  RL  AL   +  ++ +
Sbjct: 63  LLVEDVPFDEVVCRKTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKHALE-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|315178652|gb|ADT85566.1| ParA family protein [Vibrio furnissii NCTC 11218]
          Length = 257

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE    +++ +    +  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEEAPFEEVVCRKTTGHYDLIAANGDVTAAEIKLMEVFAREVRLKNALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNDNLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+ +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLANEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|167626208|ref|YP_001676502.1| cobyrinic acid ac-diamide synthase [Shewanella halifaxensis
           HAW-EB4]
 gi|167356230|gb|ABZ78843.1| Cobyrinic acid ac-diamide synthase [Shewanella halifaxensis
           HAW-EB4]
          Length = 262

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 180/258 (69%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRRVLLIDLDPQGNATMGSGIDKYTVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK    ++ +       +I    D+   E+ L     R  RL  AL+  +  D+ +
Sbjct: 63  LLVEEKPFEDVVCRDTTGKYDLIAGNGDVTAAEIKLMEFFAREVRLRNALA-PIKDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VNS L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLGAMVNSGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++     +A
Sbjct: 242 YLALAGEIIRRAEQLTQA 259


>gi|254509074|ref|ZP_05121177.1| ParA family protein [Vibrio parahaemolyticus 16]
 gi|219548007|gb|EED25029.1| ParA family protein [Vibrio parahaemolyticus 16]
          Length = 257

 Score =  261 bits (668), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   ++++      N  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDVPFSEVVCTNTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKHALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|332308608|ref|YP_004436459.1| cobyrinic acid a,c-diamide synthase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175937|gb|AEE25191.1| cobyrinic acid a,c-diamide synthase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 262

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 184/258 (71%), Gaps = 3/258 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTA+N++ ++AA    VLLIDLDPQGNA+ G G++ YD   + Y+
Sbjct: 3   KVIAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDDPNTCYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIEEK I +++I+       +I +  D+   E+ L     R  RL  AL+  + + + +
Sbjct: 63  LLIEEKPIQEVVIKETSGKYDLIAANTDVTAAEIKLMEVFAREVRLRNALA-PVRNYYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N LT+NAMAAADS+LVP+QCE++ALEGL+ L++T++++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNQLTVNAMAAADSVLVPMQCEYYALEGLTALMDTIKKLASVVNPELTIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G +VY TVIPRNVR++EAPS+G PA+ YD    GS+A
Sbjct: 182 LRTMYDPRNRLANDVSEQLKRHFGEQVYRTVIPRNVRLAEAPSFGTPAMYYDRSSTGSKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+++  R +KE+
Sbjct: 242 YLALAGEILR--RSKKES 257


>gi|154483913|ref|ZP_02026361.1| hypothetical protein EUBVEN_01619 [Eubacterium ventriosum ATCC
           27560]
 gi|149735404|gb|EDM51290.1| hypothetical protein EUBVEN_01619 [Eubacterium ventriosum ATCC
           27560]
          Length = 254

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 128/251 (50%), Positives = 184/251 (73%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTTAINLS+ LA  G+ VLL+D+DPQGNA++G+GI     + + Y+
Sbjct: 3   KIIAIANQKGGVGKTTTAINLSSCLADAGKKVLLVDIDPQGNATSGVGIMKQTLENTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L I E   ++ L  +A+ NL++IPS ++L G E+ L G ++R + L   L   +   + Y
Sbjct: 63  LFIGECTFSECLTDSAVDNLNVIPSNVNLSGAEIDLIGVENREYILKNILDT-IKDLYEY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM AADS++VP+QCE++ALEGLSQL+ T+  ++  +N  L+I GI
Sbjct: 122 IIIDCPPSLNVLTVNAMVAADSVIVPIQCEYYALEGLSQLIHTINLIQDRLNKNLEIDGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+DSR +LS +VV +V++N+   +Y T+IPRNVR++EAPSYG P  +YD K AG+ A
Sbjct: 182 VFTMYDSRTNLSTEVVENVKENIHLHIYKTLIPRNVRLAEAPSYGIPIHMYDGKSAGAIA 241

Query: 247 YLKLASELIQQ 257
           Y  LA E+I++
Sbjct: 242 YKNLAQEVIEK 252


>gi|260887469|ref|ZP_05898732.1| sporulation initiation inhibitor protein Soj [Selenomonas sputigena
           ATCC 35185]
 gi|260862756|gb|EEX77256.1| sporulation initiation inhibitor protein Soj [Selenomonas sputigena
           ATCC 35185]
          Length = 258

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 184/259 (71%), Gaps = 3/259 (1%)

Query: 1   MEEKK-SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYD 59
           MEEK  ++II +ANQKGGVGKTTT++NLS  LA +G+ VLLID DPQGNA++G GI   D
Sbjct: 1   MEEKNVAKIIAVANQKGGVGKTTTSVNLSAGLAMLGKRVLLIDSDPQGNATSGFGINKSD 60

Query: 60  RKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ 119
              + Y +LI+   I + ++ T    + ++P+ ++L G E+ L     R  RL +++   
Sbjct: 61  LTITIYQVLIDNLAIEKAVLHTGY-EVDLLPANIELAGAEIELVAAISRENRLKRSVDA- 118

Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
           +   + +I +DCPPS  LLT+NA+ AAD++L+P+QCEF+ALEGL+QL+ T+  V+  +N 
Sbjct: 119 VRDQYDFILIDCPPSLGLLTLNALTAADTVLMPIQCEFYALEGLAQLMNTMTLVQTNLNP 178

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
           AL+++G++LTMFDSR +LS QV  +VR + G KVY TVIPR VR+SEAPSYG+P I YD 
Sbjct: 179 ALEVEGVLLTMFDSRTNLSVQVAEEVRTHFGSKVYRTVIPRTVRLSEAPSYGQPVIAYDR 238

Query: 240 KCAGSQAYLKLASELIQQE 258
            C G+  Y+ LA E+I+++
Sbjct: 239 NCKGAIVYMDLAKEVIERD 257


>gi|150392468|ref|YP_001322517.1| cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens
           QYMF]
 gi|149952330|gb|ABR50858.1| Cobyrinic acid a,c-diamide synthase [Alkaliphilus metalliredigens
           QYMF]
          Length = 257

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 183/253 (72%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I + NQKGGVGKTTT +NLS  +A  G+ V +ID+DPQGN ++G GI+    +YS YD
Sbjct: 3   KVIAVFNQKGGVGKTTTNVNLSACIAQEGKRVCVIDIDPQGNTTSGFGIDKKQLEYSIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI +  I + ++ T   NL I+PS+  L G E+ L   + R  RL ++++ ++  ++ Y
Sbjct: 63  VLINDLPIEETIMHTDYENLDIVPSSAQLAGAEIELTTIQKRELRLKESIN-RIRDNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS  LLT+N++AA DS+L+P+QCE++ALEG+SQL+ T++ +++++N  L+IQG+
Sbjct: 122 IFIDCPPSLGLLTINSLAAVDSVLIPIQCEYYALEGVSQLMNTIQLIKKSLNKDLEIQGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +L+MFD R +LS QVV +V+    GKVY T+IPRNVR++EAPS+G+P I YD K  G++A
Sbjct: 182 VLSMFDGRTNLSIQVVDEVKNYFKGKVYATIIPRNVRLAEAPSFGQPIIYYDNKSKGAEA 241

Query: 247 YLKLASELIQQER 259
           Y  LA E +  E 
Sbjct: 242 YTDLAVEFLDLEE 254


>gi|90413745|ref|ZP_01221733.1| Putative ParA family protein [Photobacterium profundum 3TCK]
 gi|90325214|gb|EAS41711.1| Putative ParA family protein [Photobacterium profundum 3TCK]
          Length = 264

 Score =  261 bits (668), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 182/260 (70%), Gaps = 3/260 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ +LAA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASLAATQRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   N ++I        +I +  D+   E+ L     R  RL  AL V +  ++ +
Sbjct: 63  LLVEETPFNDVVITDTTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALEV-VRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAM AADS+LVP+QCE+FALEGL+ L++T+ ++   VN+ L I+G+
Sbjct: 122 IFIDCPPALNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNADLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+G+PA+ YD   +G++A
Sbjct: 182 LRTMFDPRNRLSNEVSQQLKKHFGDKVYRTVIPRNVRLAEAPSHGRPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQER--HRKEA 264
           YL LA E+I+++   H  +A
Sbjct: 242 YLALAGEMIRRDELAHNADA 261


>gi|157964060|ref|YP_001504094.1| cobyrinic acid ac-diamide synthase [Shewanella pealeana ATCC
           700345]
 gi|157849060|gb|ABV89559.1| Cobyrinic acid ac-diamide synthase [Shewanella pealeana ATCC
           700345]
          Length = 262

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 180/258 (69%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRRVLLIDLDPQGNATMGSGIDKYTVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK   +++ +       +I    D+   E+ L     R  RL  AL+  +  D+ Y
Sbjct: 63  LLVEEKPFEEVVCRDTNGKYDLIAGNGDVTAAEIKLMEFFAREVRLRNALA-PIKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLGAMVNHGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E+I++     +A
Sbjct: 242 YLALAGEIIRRAEQLTQA 259


>gi|188587515|ref|YP_001919060.1| chromosome segregation ATPase [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179352202|gb|ACB86472.1| chromosome segregation ATPase [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 253

 Score =  261 bits (667), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 178/252 (70%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII I NQKGGVGKTTTA+NLS  LA  G+ VLL+D+DPQGN+++G+G++        YD
Sbjct: 3   RIIAITNQKGGVGKTTTAVNLSAGLAHSGKKVLLLDIDPQGNSTSGVGVDKNKLTSCMYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI E  ++ I++ T I  L + P+T+DL G E+ L     R  +L   L   +  D  Y
Sbjct: 63  SLINETPVHNIVVNTEIDGLMVAPATIDLAGAEIELVPTISREVKLRNLLR-DIHMDLDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+DS L+P+QCE++ALEGLSQLL T++ V+  +N+AL+I+G+
Sbjct: 122 IIIDCPPSLGLLTVNALTASDSALIPIQCEYYALEGLSQLLNTIKLVQNHLNTALEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR +LS QV  +++ +    VY TVIPRNVR+SEAPSYG+P I YD K  G++ 
Sbjct: 182 LLTMYDSRTNLSAQVSEEIKNHFKDDVYKTVIPRNVRLSEAPSYGQPIITYDNKSKGAEV 241

Query: 247 YLKLASELIQQE 258
           YL+LA E++  E
Sbjct: 242 YLQLAEEVLAVE 253


>gi|160893426|ref|ZP_02074211.1| hypothetical protein CLOL250_00976 [Clostridium sp. L2-50]
 gi|156864821|gb|EDO58252.1| hypothetical protein CLOL250_00976 [Clostridium sp. L2-50]
          Length = 259

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 185/259 (71%), Gaps = 4/259 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII IANQKGGVGKTTTAINL+  LA  G+ VL +D+DPQGN ++GLGI+    +YS Y
Sbjct: 2   GRIIAIANQKGGVGKTTTAINLAACLAKKGKKVLAVDMDPQGNMTSGLGIDKNALEYSVY 61

Query: 66  DLLIEEKNINQILIQTAIPN---LSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
           D+L  + N+ + +I  A P+   L+++P++ +L G E+     +D  + L   L   +  
Sbjct: 62  DMLNGDCNLGECMIIDAYPDIKGLNLLPASRELAGAEVEFVTVEDPQYVLKNHLK-SVRR 120

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F YI +DCPP+  +LT+NA+ AA+++LVP+QCEFFAL+GLSQL+ TV  +R+ +N  L 
Sbjct: 121 KFDYIIIDCPPALGMLTVNALTAANTVLVPIQCEFFALDGLSQLIYTVNLIRKQLNRLLT 180

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+ TM+DSR +LS QVV +V++NL   +YNT+IPRNVR++EAPSYG P I YD K A
Sbjct: 181 IEGIVFTMYDSRTNLSMQVVENVKENLNQHIYNTMIPRNVRLAEAPSYGMPIIEYDPKSA 240

Query: 243 GSQAYLKLASELIQQERHR 261
           G++ Y+ LA E+I+ + ++
Sbjct: 241 GAEHYMMLADEVIENDYYK 259


>gi|229542324|ref|ZP_04431384.1| Cobyrinic acid ac-diamide synthase [Bacillus coagulans 36D1]
 gi|229326744|gb|EEN92419.1| Cobyrinic acid ac-diamide synthase [Bacillus coagulans 36D1]
          Length = 253

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/249 (49%), Positives = 180/249 (72%), Gaps = 1/249 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I+IANQKGGVGKTTT++NL   LA IG+ VLL+D DPQGNA++G GI+  + +   Y
Sbjct: 2   GKVISIANQKGGVGKTTTSVNLGACLAYIGKKVLLVDTDPQGNATSGAGIDKGEVQQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+ NI  ++  TA+  L  +P+T+ L G E+ L     R  RL +A+S  +  D+ 
Sbjct: 62  DVLVEDANIKDVIRATAVDGLYSVPATIQLAGAEIELVPTISREVRLKRAISA-IKDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G
Sbjct: 121 YIIIDCPPSLGLLTLNALTASDAVIIPVQCEYYALEGLSQLLSTVRLVQKHLNHNLMIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRN+R+SEAPS+G+P I+YD K  G++
Sbjct: 181 VLLTMLDARTNLGLQVIEEVKKYFRDKVYRTIIPRNIRLSEAPSHGQPIILYDPKSRGAE 240

Query: 246 AYLKLASEL 254
            YL LA E+
Sbjct: 241 VYLDLAKEV 249


>gi|54310651|ref|YP_131671.1| putative ParA family protein [Photobacterium profundum SS9]
 gi|46915094|emb|CAG21869.1| Putative ParA family protein [Photobacterium profundum SS9]
          Length = 264

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ +LAA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASLAATQRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE   N ++I        +I +  D+   E+ L     R  RL  AL V +  ++ +
Sbjct: 63  LLVEETPFNDVVITDTTGGYHLIAANGDVTAAEIKLMEVFAREVRLRNALEV-VRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAM AADS+LVP+QCE+FALEGL+ L++T+ ++   VN+ L I+G+
Sbjct: 122 IFIDCPPALNLLTINAMTAADSVLVPMQCEYFALEGLTALMDTISKLTAVVNADLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+G+PA+ YD   +G++A
Sbjct: 182 LRTMFDPRNRLSNEVSQQLKKHFGDKVYRTVIPRNVRLAEAPSHGRPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E+I+++
Sbjct: 242 YLALAGEMIRRD 253


>gi|302872904|ref|YP_003841540.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           obsidiansis OB47]
 gi|302575763|gb|ADL43554.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 263

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ I NQKGGVGKTTT +NLS A++ IG+ VL +D DPQGN ++G GI+      ++Y
Sbjct: 2   ARIVAIVNQKGGVGKTTTCVNLSAAISKIGKKVLAVDCDPQGNLTSGFGIDKKSLTRTTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   +  + +I+    NLS++P+ ++L G E+ L     R  RL  A+  ++  ++ 
Sbjct: 62  DVLIGSCSAEEAVIKNKFENLSVLPANVNLAGAEIELVSMIARELRLKDAIE-KIKVEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQL  T+  VR+ +N  L+I G
Sbjct: 121 YIFIDCPPSLGLLTLNALVAADSVIIPIQCEYYALEGLSQLSNTISLVRKHLNKRLEIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS +VV +V++  G KV+ +VIPRNVR+SEAPS+G P IIYD    G++
Sbjct: 181 VVLTMFDSRTNLSLEVVEEVKRYFGQKVFLSVIPRNVRLSEAPSFGLPGIIYDPDSKGAK 240

Query: 246 AYLKLASELIQQ 257
           AY++LA E I +
Sbjct: 241 AYIELAEEYINR 252


>gi|331092102|ref|ZP_08340933.1| hypothetical protein HMPREF9477_01576 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330402303|gb|EGG81874.1| hypothetical protein HMPREF9477_01576 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 255

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 187/251 (74%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT+INLS  L+A+G+ VL ID+DPQGN ++GLGI+  + +Y+ YD
Sbjct: 3   RIIAIANQKGGVGKTTTSINLSACLSALGKKVLAIDMDPQGNMTSGLGIDKDNVEYTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I E  I +++ +  + NL ++P+ +DL   E+ L G  ++ + +  A+   +   + +
Sbjct: 63  LIIGETEIEKVICKDTLENLDVLPTNIDLSAAEIELIGVDNKEYIIRDAVDT-VKEMYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NAM  AD++LVP+QCE++ALEGLSQL+ T++ V+  +N  L+++G+
Sbjct: 122 IIIDCPPSLSMLTINAMTTADTVLVPIQCEYYALEGLSQLIHTIDLVKERLNPKLEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRN+R++EAPS+G P  +YD K AG+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLNKAIYKTIIPRNIRLAEAPSHGLPINLYDPKSAGAES 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMLLAEEVINK 252


>gi|210614285|ref|ZP_03290156.1| hypothetical protein CLONEX_02370 [Clostridium nexile DSM 1787]
 gi|210150769|gb|EEA81778.1| hypothetical protein CLONEX_02370 [Clostridium nexile DSM 1787]
          Length = 255

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 190/251 (75%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINLS+ LA++G+ VL ID+DPQGN ++GLGI+  + +Y+ Y+
Sbjct: 3   RIIAVANQKGGVGKTTTAINLSSCLASLGKKVLAIDMDPQGNMTSGLGIDKNEVEYTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L++ +  I +++ + A+ NL ++P+ ++L   E+ L G +++ F + K +  ++  ++ +
Sbjct: 63  LILGQVGIEKVICKDALENLDVLPTNINLSAAEIELIGVEEKEFIIRKEVD-KVKKNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NAM  ADS+LVP+QCE++ALEGLSQL+ T++ V+  +N  L I+G+
Sbjct: 122 IVIDCPPSLSMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTIDLVKERLNPELKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPS+G P  +YD K +G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLQQTIYKTIIPRNIRLAEAPSHGLPINLYDPKSSGAES 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMLLAEEVINK 252


>gi|323705838|ref|ZP_08117410.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534834|gb|EGB24613.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 275

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 188/256 (73%), Gaps = 2/256 (0%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           +K  ++I +ANQKGGVGKTTT INL  +L+A G+ VL +D+DPQ N ++G GI+    K 
Sbjct: 15  DKLGKVIAVANQKGGVGKTTTTINLGYSLSATGKKVLCVDMDPQSNMTSGFGIDSSSIKC 74

Query: 63  SSYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
           ++Y++LIE K+I +  I+   +  ++I+PS++ L G E+ L     R FRL  +++ ++ 
Sbjct: 75  TTYNILIEGKDIREAYIELEDMSGITIVPSSIQLAGAEIELVPMLSREFRLKNSIN-EIK 133

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            +F YI +DCPPS  LLT+NA+ A+DS+LVP+QCE++ALEGL+QL+ T+  +++ +N  L
Sbjct: 134 KEFDYIIIDCPPSLGLLTINALTASDSVLVPIQCEYYALEGLTQLMNTINLIKKNINHDL 193

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           +I+G++LTMF++R +LS QVV +V+K   GKVY T+IPRN+R+ EAPS+GKP  +YD   
Sbjct: 194 EIEGVVLTMFNARTNLSIQVVDEVKKYFKGKVYGTIIPRNIRLGEAPSFGKPISLYDPHS 253

Query: 242 AGSQAYLKLASELIQQ 257
            G++AY +LA ELI++
Sbjct: 254 KGAEAYEELAKELIER 269


>gi|95929978|ref|ZP_01312718.1| Cobyrinic acid a,c-diamide synthase [Desulfuromonas acetoxidans DSM
           684]
 gi|95133947|gb|EAT15606.1| Cobyrinic acid a,c-diamide synthase [Desulfuromonas acetoxidans DSM
           684]
          Length = 255

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 185/251 (73%), Gaps = 1/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + II IANQKGGVGKTTTA+NLS +LA   +  LL+D+DPQGNA +G+G+   + + + Y
Sbjct: 2   AEIIAIANQKGGVGKTTTAVNLSASLAVAEKKTLLVDMDPQGNACSGVGVVTEELEVTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D L +   + + +++T +  L+++PST DL+G E+ L     R +RL   ++ Q+ +D+ 
Sbjct: 62  DTLHDPLLVKEGIVKTQLDFLNVLPSTTDLIGAELELVAADRREYRLSNVIN-QVAADYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ AA S++VPLQCE++A+EGLSQL++T+  V++ +N+ L ++G
Sbjct: 121 YIIIDCPPSLGLLTINSLTAAGSVIVPLQCEYYAMEGLSQLMKTIGLVQQGLNTRLSLRG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD RN+LS QV  +VR++   KV+ +VIPRNVR+SEAPS+G P ++YD+   G+ 
Sbjct: 181 IVLTMFDRRNNLSHQVSEEVREHFQEKVFKSVIPRNVRLSEAPSHGAPVLLYDVSSRGAT 240

Query: 246 AYLKLASELIQ 256
           AYL LA E+I+
Sbjct: 241 AYLDLAQEVIK 251


>gi|126724523|ref|ZP_01740366.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           HTCC2150]
 gi|126705687|gb|EBA04777.1| chromosome partitioning protein ParA [Rhodobacterales bacterium
           HTCC2150]
          Length = 270

 Score =  261 bits (667), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 133/263 (50%), Positives = 175/263 (66%), Gaps = 2/263 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
            + +II++ NQKGGVGKTTT IN+  ALAA G NVLL+DLDPQGNASTGLG     R  +
Sbjct: 8   HEPKIISVVNQKGGVGKTTTTINIGAALAAQGMNVLLVDLDPQGNASTGLGFPASVRGKT 67

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS- 122
           +YDLL++E  I +++  T    L + P+T DL   +M L   + R F L  +L       
Sbjct: 68  TYDLLLDEAPIEEVVHDTEFEGLFLAPATTDLSSADMELVSNEKRTFLLRDSLRQPAMEK 127

Query: 123 -DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            +F ++ +DCPPS N+LT+NAM A+ SILVPLQ EF+ALEGLSQL+ TV EVR   N  L
Sbjct: 128 FEFDFVLIDCPPSLNMLTINAMVASHSILVPLQTEFYALEGLSQLMLTVREVREAANRDL 187

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
             +G++LTM+D RN+L++QV +D R NLG  V+ T IPRNVRISEAPS+  P + YD   
Sbjct: 188 RFEGVVLTMYDGRNNLARQVEADARDNLGDMVFETRIPRNVRISEAPSFAMPVLSYDPSS 247

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
            G+ AY  LA E++ +     EA
Sbjct: 248 TGAVAYSALAKEILIKNNIMAEA 270


>gi|308071635|ref|YP_003873240.1| sporulation initiation inhibitor protein soj [Paenibacillus
           polymyxa E681]
 gi|305860914|gb|ADM72702.1| Sporulation initiation inhibitor protein soj [Paenibacillus
           polymyxa E681]
          Length = 253

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II +ANQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAVANQKGGVGKTTTSVNLGAGLASLGKRVLLVDIDPQGNTTSGVGINKADVANCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E + ++ ++ T +  L IIP+T+ L G E+ L     R  RL ++L + +  ++ 
Sbjct: 62  DVLINEVDPSEAIMSTQVEGLDIIPATIQLAGAEIELVPTISRELRLKRSLQL-VKHNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ A+DS+++P+QCE++ALEGLSQLL TV  V++ +N++L I+G
Sbjct: 121 YILIDCPPSLGILTLNSLTASDSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMFDARTNLGIQVIEEVKKYFQSKVYQTIIPRNVRLSEAPSHGQSIITYDPRSRGAE 240

Query: 246 AYLKLASELIQQE 258
            Y++LA E++  E
Sbjct: 241 VYIELAKEVVSYE 253


>gi|229164431|ref|ZP_04292359.1| Chromosome segregation ATPase [Bacillus cereus R309803]
 gi|228619036|gb|EEK75934.1| Chromosome segregation ATPase [Bacillus cereus R309803]
          Length = 253

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT++NL   LA  G+ VLL+D+D QGNA+TG+GIE  +     Y
Sbjct: 2   GKIIAIANQKGGVGKTTTSVNLGAGLAQAGKKVLLVDIDAQGNATTGVGIEKSELDQCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+ ++  ++ +TA  NL ++P+T+ L G E+ L     R  RL +AL   +  ++ 
Sbjct: 62  NVLVEDADVQGVIRKTATENLDVLPATIQLAGAEIELVPTISREVRLQRALQ-PVRDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQLL TV  V++ +N  L IQG
Sbjct: 121 YIIIDCPPSLGLLTINALTAADSVIIPVQCEYYALEGLSQLLNTVRLVQKHLNKNLAIQG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY ++IPRNVR+SEAPS+GKP + YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIDEVKKYFRDKVYRSIIPRNVRLSEAPSHGKPIMQYDAKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E+I
Sbjct: 241 VYIDLAEEVI 250


>gi|225377570|ref|ZP_03754791.1| hypothetical protein ROSEINA2194_03220 [Roseburia inulinivorans DSM
           16841]
 gi|225210546|gb|EEG92900.1| hypothetical protein ROSEINA2194_03220 [Roseburia inulinivorans DSM
           16841]
          Length = 261

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 187/257 (72%), Gaps = 1/257 (0%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E    RII +ANQKGGVGKTTTAINL+  LA  G+ VL IDLDPQGN ++GLG++  + +
Sbjct: 4   ENIMGRIIAVANQKGGVGKTTTAINLAACLAEAGKKVLTIDLDPQGNMTSGLGVDKNEVE 63

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            + Y+L+++E +I + +  T +  + +IPS ++L G E+ L G  ++ + L  A+   + 
Sbjct: 64  NTVYELMLDECSIKESMTDTVVDGMKVIPSNVNLAGAEIELLGIPEKEYILRNAVD-YIK 122

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D+ +I +DCPPS N+LT+NAM  A+S+LVP+QCE++ALEGLSQL+ T++ V++ +N  L
Sbjct: 123 EDYDFIVIDCPPSLNMLTINAMTTANSVLVPIQCEYYALEGLSQLIHTIDLVQQRLNPNL 182

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++ TM+D R +LS QVV +VR NL  K+Y+T+IPRN+R++EAPSYG P  +YD K 
Sbjct: 183 LIEGVVFTMYDVRTNLSNQVVENVRNNLDAKIYDTLIPRNIRLAEAPSYGLPINLYDSKS 242

Query: 242 AGSQAYLKLASELIQQE 258
           AG+++Y  LA E+I ++
Sbjct: 243 AGAESYRLLAKEVIDRK 259


>gi|212637842|ref|YP_002314367.1| cobyrinic acid a,c-diamide synthase [Shewanella piezotolerans WP3]
 gi|212559326|gb|ACJ31780.1| Cobyrinic acid a,c-diamide synthase [Shewanella piezotolerans WP3]
          Length = 262

 Score =  261 bits (666), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y+ + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRRVLLIDLDPQGNATMGSGIDKYEVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK+  +++ +       +I    D+   E+ L     R  RL  AL+  +  D+ +
Sbjct: 63  LLVEEKSFEEVVCRDTNGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PIKDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLGSMVNPGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLALAGEIIRR 252


>gi|294143115|ref|YP_003559093.1| ParA family protein [Shewanella violacea DSS12]
 gi|293329584|dbj|BAJ04315.1| ParA family protein [Shewanella violacea DSS12]
          Length = 262

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/256 (48%), Positives = 183/256 (71%), Gaps = 2/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++EK  ++++ +       +I    D+   E+ L     R  RL  AL+  +  D+ +
Sbjct: 63  LLVDEKPFDEVVYRDTSGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PIKDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   +N  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKIGAMINPGLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQ-ERHR 261
           YL LA E+I++ E+H+
Sbjct: 242 YLALAGEIIRRAEQHQ 257


>gi|317133700|ref|YP_004093014.1| cobyrinic acid a,c-diamide synthase [Ethanoligenens harbinense
           YUAN-3]
 gi|315471679|gb|ADU28283.1| cobyrinic acid a,c-diamide synthase [Ethanoligenens harbinense
           YUAN-3]
          Length = 261

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 182/260 (70%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGVGKTTT +NL+ AL  +G+ VLL D+DPQGNA++G+G+   +   S+Y
Sbjct: 2   GKIIAIANQKGGVGKTTTTVNLAAALGELGQRVLLTDVDPQGNATSGMGVNKRELPKSTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI +     +L+ T   N+ I+P+ ++L G E+ L   + R   L +   + +   + 
Sbjct: 62  DILIGQATAEDVLVHTQFQNVDILPANIELAGAEIELVDAEHREEMLKRTF-LPVREQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  L+T+NA++AAD++L+P QCE++ALEGLSQL+ TV  V+R  N +++I+G
Sbjct: 121 YILIDCPPSLGLITLNALSAADTLLIPAQCEYYALEGLSQLIATVRMVKRLYNPSIEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +L+ QVV +++K    KVY TV+PRNVRISEAPS+G+P + YD    GS+
Sbjct: 181 VLLTMFDGRLNLTMQVVQEIKKFFPRKVYKTVVPRNVRISEAPSFGQPVLYYDGHSKGSE 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AY +LA E+ +Q   +K  A
Sbjct: 241 AYRELALEIEEQNTEKKGTA 260


>gi|255994562|ref|ZP_05427697.1| sporulation initiation inhibitor protein Soj [Eubacterium saphenum
           ATCC 49989]
 gi|255993275|gb|EEU03364.1| sporulation initiation inhibitor protein Soj [Eubacterium saphenum
           ATCC 49989]
          Length = 258

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 181/253 (71%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I I NQKGGVGKTTT INL+T LA   + VL+ID+DPQGN ++GLGIE      + Y
Sbjct: 2   SKLIAIFNQKGGVGKTTTNINLATCLATNKKRVLVIDIDPQGNTTSGLGIEKNKLDNTIY 61

Query: 66  DLLIEEK-NINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +LL +EK N   ++I T I N+ IIPS ++L G E+ L  +  R  RL  AL+  +  D+
Sbjct: 62  ELLTDEKVNAKDVIIPTGIKNMDIIPSNVELAGAELELSAQYGREKRLKNALA-SVKEDY 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DCPPS  LLT+N + A DS+L+P+QCEF+ALEG+SQL+ T++ V++ +N  L I+
Sbjct: 121 DYVLVDCPPSLGLLTINTLTAVDSVLIPIQCEFYALEGVSQLMSTIDLVKKNLNEDLKIE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++L+MFD+R  LS +V ++VRK   G +Y+TVIPRNVR++EAPS+G P + YD   AG+
Sbjct: 181 GVVLSMFDNRTKLSAEVQNEVRKYFKGLLYDTVIPRNVRLAEAPSHGIPIVHYDPSSAGA 240

Query: 245 QAYLKLASELIQQ 257
           +AY K A E +++
Sbjct: 241 KAYKKFAKEFLKR 253


>gi|239624147|ref|ZP_04667178.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520533|gb|EEQ60399.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 256

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 185/254 (72%), Gaps = 7/254 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RIITI NQKGGVGKTTTAINLS  LA  G+ VLL+D DPQGNAS+GLG+E  D   + YD
Sbjct: 3   RIITITNQKGGVGKTTTAINLSACLAEAGQKVLLVDFDPQGNASSGLGLEREDFDKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV---QLTSD 123
           +LIEE   ++ +++   PN+ ++PS M+L G E+    E   +   +K LS+   Q+   
Sbjct: 63  MLIEEAPADECIVKEIQPNMDVLPSDMNLAGAEI----EFQEVEEKEKLLSIYLNQVRDT 118

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + +I +DCPPS N+LT+NA+ AAD++LVP+QCE++ALEGLSQ+L+TV+ V+R +N  L++
Sbjct: 119 YDFILIDCPPSLNILTINALTAADTVLVPIQCEYYALEGLSQVLKTVDLVKRKLNPDLEL 178

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++ TM+D+R +LS +VV  V+ +L   +Y T+IPRNVR++EAPS+G    +YD +  G
Sbjct: 179 EGVVFTMYDARTNLSLEVVESVKSSLNRTIYKTIIPRNVRLAEAPSHGMSINLYDSRSTG 238

Query: 244 SQAYLKLASELIQQ 257
           +++Y  LA+E++ +
Sbjct: 239 AESYRLLAAEVMSR 252


>gi|291526558|emb|CBK92145.1| ATPases involved in chromosome partitioning [Eubacterium rectale
           DSM 17629]
 gi|291529200|emb|CBK94786.1| ATPases involved in chromosome partitioning [Eubacterium rectale
           M104/1]
          Length = 255

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT+INL+  LA   + VL IDLDPQGN ++GLG+   + + + Y+
Sbjct: 3   RIIAVANQKGGVGKTTTSINLAACLAEKKKKVLAIDLDPQGNMTSGLGVNKDEVENTVYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+++E +I + +  T + NL +IPS ++L G E+ L G  D+ + L  A+   +  D+ +
Sbjct: 63  LMLDECSIAESIENTVVDNLYVIPSNVNLAGAEIELLGINDKEYILKSAVD-YIKEDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM  AD++LVP+QCE++ALEGLSQL+ T+  V+  +N  L I+G+
Sbjct: 122 IIIDCPPSLNMLTVNAMTTADTVLVPIQCEYYALEGLSQLIHTINLVQERLNPELQIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D R +LS QVV  V++NL  K+YNT+IPRN+R++EAPSYG P  +YD K AG+++
Sbjct: 182 VFTMYDVRTNLSNQVVETVKENLDTKIYNTMIPRNIRLAEAPSYGIPINMYDSKSAGAES 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I ++
Sbjct: 242 YRNLAKEIIARK 253


>gi|302393069|ref|YP_003828889.1| cobyrinic acid ac-diamide synthase [Acetohalobium arabaticum DSM
           5501]
 gi|302205146|gb|ADL13824.1| Cobyrinic acid ac-diamide synthase [Acetohalobium arabaticum DSM
           5501]
          Length = 253

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
            II + NQKGGVGK+TTAINLS +L    + VLL+D+DPQGNAS+G+G++  +     YD
Sbjct: 3   EIIAVVNQKGGVGKSTTAINLSASLTEFEKKVLLVDIDPQGNASSGVGLDKEEINCCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI       I++ T + NL + P+T++L G E+ L  +  R  RLDKA++     D+ Y
Sbjct: 63  VLINGYQFKDIIVGTELENLDLAPATLELAGAEIELVSKLSREERLDKAITTA-ELDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS +LLT+NA+ AADS+L+P+QCE++ALEGLSQLL T++ V+  +N  L I G+
Sbjct: 122 IFIDCPPSLSLLTLNALTAADSVLIPIQCEYYALEGLSQLLNTIDLVQSNLNQNLGINGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +LS QV  +V     G+VY TVIPRNVR+SEAPS+G+P  +YD    G++A
Sbjct: 182 VLTMHDTRTNLSHQVKEEVCNYFEGEVYETVIPRNVRLSEAPSFGQPINLYDKSSKGAKA 241

Query: 247 YLKLASELIQQE 258
           YL+LA E++  E
Sbjct: 242 YLELAKEVVDNE 253


>gi|332533709|ref|ZP_08409568.1| chromosome (plasmid) partitioning protein ParA / sporulation
           initiation inhibitor protein Soj [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036873|gb|EGI73334.1| chromosome (plasmid) partitioning protein ParA / sporulation
           initiation inhibitor protein Soj [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 261

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ Y    + Y
Sbjct: 2   AKVIALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYGDVPTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE+K I  ++I+       +I +  D+   E+ L     R  RL  AL  ++   + 
Sbjct: 62  DLLIEDKPIEDVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALE-KIQDQYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N+LT+NAMAAADSILVP+QCE++ALEGL+ L++T+ ++ + VN +L I+G
Sbjct: 121 FIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPSLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKQHFGDKVYRTVIPRNVRLAEAPSFGTPAMYYDRASSGAK 240

Query: 246 AYLKLASELIQQE 258
           AYL LA E+++++
Sbjct: 241 AYLALAGEMLRRK 253


>gi|114778891|ref|ZP_01453688.1| ParA, ParA family ATPase [Mariprofundus ferrooxydans PV-1]
 gi|114550860|gb|EAU53426.1| ParA, ParA family ATPase [Mariprofundus ferrooxydans PV-1]
          Length = 262

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 183/256 (71%), Gaps = 4/256 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           I  IANQKGGVGKTTT+INL+ +LAA+ + VLLIDLDPQGN+++GLG+     +  +YD+
Sbjct: 9   ITAIANQKGGVGKTTTSINLAASLAALEKRVLLIDLDPQGNSTSGLGVNQNTVRSGTYDV 68

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           L+ +  ++  +I T    L ++P++MDL G E+ L  E  R  RL++A +      F Y+
Sbjct: 69  LMGDAQLSDAIIATDCERLLLLPASMDLAGAEIELVSELGRELRLEQAFAAYKGEAFDYV 128

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
           F+DCPP+ +LLT+NA++A+D ++V LQ EF+A+EGL+QL++++  +++ +NS+L ++GI+
Sbjct: 129 FIDCPPALSLLTVNALSASDHVMVTLQTEFYAMEGLTQLMDSIRRIKQALNSSLTMEGIL 188

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM D RN LS QV  DVR   G +VY   IPRNVR+SEAPS+G P + +D++  G+QAY
Sbjct: 189 LTMVDGRNRLSTQVEEDVRAYFGSQVYANTIPRNVRLSEAPSFGVPVMYHDVRSKGAQAY 248

Query: 248 LKLASELIQQERHRKE 263
           L +A E +    HR+E
Sbjct: 249 LVVAQEFM----HRRE 260


>gi|262277798|ref|ZP_06055591.1| chromosome partitioning protein ParA [alpha proteobacterium
           HIMB114]
 gi|262224901|gb|EEY75360.1| chromosome partitioning protein ParA [alpha proteobacterium
           HIMB114]
          Length = 259

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 179/252 (71%), Gaps = 2/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II+I NQKGGVGKTT+ INL  ALA+ G+ +L+IDLDPQGNASTGLGI+   R+ + Y
Sbjct: 2   TKIISIINQKGGVGKTTSTINLGHALASSGQKILVIDLDPQGNASTGLGIDRGKREKTIY 61

Query: 66  DLLIEEKN-INQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLTSD 123
           + L+   +  N  + +T   NL II +  DL G E  +  E  R F L   L  ++  + 
Sbjct: 62  EFLVSRNDDPNSFISKTKTENLDIICANEDLSGFETEVADESKRAFFLRDVLDQIKEKNQ 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           +++I +DCPPS +LLT+ A+ A+D++++PLQ EFFALEG+SQL++T+E V+  +N  L I
Sbjct: 122 YNHILIDCPPSLSLLTIMALVASDTVIIPLQTEFFALEGVSQLIKTIERVKENLNKNLSI 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           QG+ILTM+D RN LS QV  + RK  G KVY TVIPRNVRISEAPS+G P I+YD   +G
Sbjct: 182 QGVILTMYDRRNKLSSQVEQEARKYFGSKVYKTVIPRNVRISEAPSHGMPVIVYDKNSSG 241

Query: 244 SQAYLKLASELI 255
           S AY +L++E++
Sbjct: 242 SIAYQELSNEIL 253


>gi|315128178|ref|YP_004070181.1| partitioning protein A [Pseudoalteromonas sp. SM9913]
 gi|315016691|gb|ADT70029.1| partitioning protein A [Pseudoalteromonas sp. SM9913]
          Length = 261

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 183/253 (72%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ Y    + Y
Sbjct: 2   AKVIALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYGDVPTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE+K I++++I+       +I +  D+   E+ L     R  RL  AL  ++   + 
Sbjct: 62  DLLIEDKPIDEVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALE-KIQDQYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N+LT+NAMAAADSILVP+QCE++ALEGL+ L++T+ ++ + VN  L I+G
Sbjct: 121 FIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPNLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDRASSGAK 240

Query: 246 AYLKLASELIQQE 258
           AYL LA E+++++
Sbjct: 241 AYLALAGEMLRRK 253


>gi|260774971|ref|ZP_05883871.1| ParA family protein [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609061|gb|EEX35220.1| ParA family protein [Vibrio coralliilyticus ATCC BAA-450]
          Length = 257

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    ++Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+   + ++ +    N  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDVAFDDVVCRKTSGNYDLIAANGDVTAAEIKLMEVFAREVRLKHALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E+++++
Sbjct: 242 YLALAGEMLRRD 253


>gi|162147021|ref|YP_001601482.1| chromosome partitioning protein parA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544083|ref|YP_002276312.1| Cobyrinic acid ac-diamide synthase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785598|emb|CAP55169.1| putative chromosome partitioning protein parA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531760|gb|ACI51697.1| Cobyrinic acid ac-diamide synthase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 265

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 183/256 (71%), Gaps = 1/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ +ANQKGGVGKTTTAINL+  LAA G +VLLIDLDPQGNASTGLG+    R+  +Y 
Sbjct: 3   RILALANQKGGVGKTTTAINLAAGLAAQGLSVLLIDLDPQGNASTGLGVGYDARRLGTYA 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+++     ++  T IPNL+II +  +L G E+ L  +  R FRL  A++ ++ S +  
Sbjct: 63  LLMDDAAAADLVQATEIPNLAIIAADTELAGAELELVMQDRREFRLRDAIA-RVGSGYDV 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+D ++VPLQCEFFALEG+SQL+ T++ VRR  NS L + GI
Sbjct: 122 ILIDCPPSLGLLTLNALVASDGVVVPLQCEFFALEGISQLVRTIDRVRRAFNSDLHVAGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D RN+LS+ V +D R   G +V +T+IPRN+RISEA S+G+  + YD K +G+ A
Sbjct: 182 VLTMYDRRNNLSELVAADARGFFGDQVMDTLIPRNIRISEAQSHGRSVMAYDAKSSGAMA 241

Query: 247 YLKLASELIQQERHRK 262
           Y  +A ELI + +  K
Sbjct: 242 YQAMAKELIARMKLAK 257


>gi|56422025|ref|YP_149343.1| sporulation initiation inhibitor protein [Geobacillus kaustophilus
           HTA426]
 gi|261420898|ref|YP_003254580.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC61]
 gi|297531683|ref|YP_003672958.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. C56-T3]
 gi|319768569|ref|YP_004134070.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC52]
 gi|56381867|dbj|BAD77775.1| sporulation initiation inhibitor protein [Geobacillus kaustophilus
           HTA426]
 gi|261377355|gb|ACX80098.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC61]
 gi|297254935|gb|ADI28381.1| Cobyrinic acid ac-diamide synthase [Geobacillus sp. C56-T3]
 gi|317113435|gb|ADU95927.1| cobyrinic acid ac-diamide synthase [Geobacillus sp. Y412MC52]
          Length = 253

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I IANQKGGVGKTTTA+NLS  LA +G+ VLL+D DPQGNA++G+GIE  D     Y
Sbjct: 2   GKVIAIANQKGGVGKTTTAVNLSACLAHLGKKVLLVDADPQGNATSGIGIERGDVDECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +++I +     ++  T I NL +IP+T+ L G E+ L     R  RL  A+   L   + 
Sbjct: 62  NVIIGDMKAKDVIRPTDIENLYVIPATIQLAGAEIELVSVISREIRLRNAIE-PLKDKYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA+S+L+P+QCE++ALEGLSQLL T+  V+R +N  L ++G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAANSVLIPVQCEYYALEGLSQLLNTIRLVQRHLNYDLRLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+GKP I+YD+K  G++
Sbjct: 181 VLLTMLDARTNLGLQVIQEVKKYFREKVYQTIIPRNVRLSEAPSHGKPIILYDVKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            YL+LA E++++
Sbjct: 241 VYLELAKEVLER 252


>gi|163787909|ref|ZP_02182355.1| regulator protein; cell division inhibitor [Flavobacteriales
           bacterium ALC-1]
 gi|159876229|gb|EDP70287.1| regulator protein; cell division inhibitor [Flavobacteriales
           bacterium ALC-1]
          Length = 255

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L A+ + VLLID DPQ NAS+GLGI++   +  SY 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGALEKKVLLIDADPQANASSGLGIDVDAVEIGSYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L   K   + ++ +  PN+ +IP+ +DL+ IE+ L  + +R + L KA+ V L S++ Y
Sbjct: 63  VLEHTKPAKEAIVASNAPNVDVIPAHIDLVAIEIELVDKDEREYMLKKAV-VDLKSEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+++P+QCE+FALEGL +LL T++ V++  N ALDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNEALDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V+K+    V++T+I RNVR+ EAPSYG+  I YD+   G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVQKHFTDMVFDTIIQRNVRLGEAPSYGESIINYDVSSKGAAN 241

Query: 247 YLKLASELIQQ 257
           YL LA ELI++
Sbjct: 242 YLSLAKELIKK 252


>gi|319954290|ref|YP_004165557.1| cobyrinic acid ac-diamide synthase [Cellulophaga algicola DSM
           14237]
 gi|319422950|gb|ADV50059.1| Cobyrinic acid ac-diamide synthase [Cellulophaga algicola DSM
           14237]
          Length = 257

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 183/255 (71%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT +NL+ AL  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTTVNLAAALGVLEKKVLLIDADPQANATSGLGIDVDSIEIGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL   K   +I+I+T  PN+ +IP+ +DL+ IE+ L  +++R + + K++ + L   + Y
Sbjct: 63  LLEHTKTAEEIIIETTSPNVDLIPAHIDLVAIEIELVDKEEREYMMKKSI-LSLKEKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ ++R  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSIQRIHNPDLDIEGM 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +VRK+    V++T+I RNVR+SEAPSYG+  I YD    G++ 
Sbjct: 182 LLTMYDSRLRLSNQVVEEVRKHFSEMVFDTIIQRNVRLSEAPSYGESIIKYDASSKGAEN 241

Query: 247 YLKLASELIQQERHR 261
           YL LA E++ + + +
Sbjct: 242 YLSLAQEVLNKNKEK 256


>gi|225873767|ref|YP_002755226.1| chromosome partitioning protein parA [Acidobacterium capsulatum
           ATCC 51196]
 gi|225794429|gb|ACO34519.1| chromosome partitioning protein parA [Acidobacterium capsulatum
           ATCC 51196]
          Length = 283

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 179/255 (70%), Gaps = 3/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+++ + NQKGGVGKTTTAINLS ALA  G   LLID DPQ N+S GLGI   D + S+Y
Sbjct: 2   SKVLAVVNQKGGVGKTTTAINLSAALALEGLPTLLIDCDPQANSSGGLGIARDDERKSTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E  + +  + T IP LS++PS+ +L+G  + L  ++ R F++ +AL   +   ++
Sbjct: 62  DVLIGECTLEEATLPTEIPTLSVVPSSKNLIGANVELIQQEQRAFKMKQALDA-VREKYT 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPP+ +LLT+N++ AAD +LVP+Q E+FALEG+S+L+ T+E VR   N  L I+G
Sbjct: 121 YILLDCPPALDLLTLNSLVAADGLLVPMQAEYFALEGISELMHTLERVREAFNEKLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D R +L+QQV  ++R     K++ T IPRNVR++EAPSYGKP  +YD +  G++
Sbjct: 181 VLLTMYDDRTNLAQQVTENLRGFFQEKLFQTTIPRNVRLAEAPSYGKPVALYDPRSRGAE 240

Query: 246 AYLKLASELIQQERH 260
            Y  LA EL+   RH
Sbjct: 241 TYQALALELLG--RH 253


>gi|238926040|ref|YP_002939558.1| ParA, ParA family ATPase [Eubacterium rectale ATCC 33656]
 gi|238877717|gb|ACR77424.1| ParA, ParA family ATPase [Eubacterium rectale ATCC 33656]
          Length = 255

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTT+INL+  LA   + VL IDLDPQGN ++GLG+   + + + Y+
Sbjct: 3   RIIAVANQKGGVGKTTTSINLAACLAEKKKKVLAIDLDPQGNMTSGLGVNKDEVENTVYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+++E +I + +  T + NL +IPS ++L G E+ L G  D+ + L  A+   +  D+ +
Sbjct: 63  LMLDECSIAESIENTVVDNLYVIPSNVNLAGAEIELLGINDKEYILKGAVD-YIKEDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM  AD++LVP+QCE++ALEGLSQL+ T+  V+  +N  L I+G+
Sbjct: 122 IIIDCPPSLNMLTVNAMTTADTVLVPIQCEYYALEGLSQLIHTINLVQERLNPELQIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D R +LS QVV  V++NL  K+YNT+IPRN+R++EAPSYG P  +YD K AG+++
Sbjct: 182 VFTMYDVRTNLSNQVVETVKENLDTKIYNTMIPRNIRLAEAPSYGIPINMYDSKSAGAES 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I ++
Sbjct: 242 YRNLAKEIIARK 253


>gi|330813395|ref|YP_004357634.1| chromosome (plasmid) partitioning protein ParA / Sporulation
           initiation inhibitor protein Soj [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486490|gb|AEA80895.1| chromosome (plasmid) partitioning protein ParA / Sporulation
           initiation inhibitor protein Soj [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 266

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 182/255 (71%), Gaps = 1/255 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + +++I NQKGGVGKTT+ INL  A A +G+ +L+IDLDPQGNASTG+GIE  DR  S Y
Sbjct: 2   NHVVSIINQKGGVGKTTSTINLGCAFANLGQKILIIDLDPQGNASTGVGIENNDRDNSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS-VQLTSDF 124
            LL +  N+   +  T I NL II + ++L G E  +   K+R F L + L  ++  + +
Sbjct: 62  RLLNDRNNLQYYVKPTKIENLDIICANVELSGFETEVAEVKNRAFILKEILGDLKEKNQY 121

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
           + I +DCPPS +LLT+ A+ A++S++VPLQ EFFALEGL+QLL+T+  ++ ++N +L+I+
Sbjct: 122 NQILIDCPPSLSLLTVMALVASNSVIVPLQAEFFALEGLTQLLKTINRIKSSLNKSLEIE 181

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+LTMFD RN L  QV  + RK    +VY T+IPRN+RISEAPS+G P ++YD  CAGS
Sbjct: 182 GIVLTMFDKRNKLCSQVEDEARKFFSEQVYQTMIPRNIRISEAPSHGLPVLVYDKYCAGS 241

Query: 245 QAYLKLASELIQQER 259
            AY KLA E+I +++
Sbjct: 242 MAYEKLALEIIDKQK 256


>gi|77361913|ref|YP_341488.1| partitioning protein A [Pseudoalteromonas haloplanktis TAC125]
 gi|76876824|emb|CAI88046.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 261

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 181/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ Y    + Y
Sbjct: 2   AKVIALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYGDVPTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE K I +++I+       +I +  D+   E+ L     R  RL  AL  ++   + 
Sbjct: 62  DLLIENKPIEEVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALE-KIQDQYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N+LT+NAMAAADSILVP+QCE++ALEGL+ L++T+ ++ + VN  L I+G
Sbjct: 121 FIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPKLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDRASSGAK 240

Query: 246 AYLKLASELIQQE 258
           AYL LA E+++++
Sbjct: 241 AYLALAGEMLRRK 253


>gi|317130998|ref|YP_004097280.1| centromere-like function involved in forespore chromosome partition
           [Bacillus cellulosilyticus DSM 2522]
 gi|315475946|gb|ADU32549.1| centromere-like function involved in forespore chromosome partition
           [Bacillus cellulosilyticus DSM 2522]
          Length = 253

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 180/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I IANQKGGVGKTT+A+NLS  LA +G   LLID+DPQGN ++G+GI+  D  +  Y
Sbjct: 2   GKVIAIANQKGGVGKTTSAVNLSACLAHLGNKTLLIDIDPQGNTTSGVGIDKGDVDHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L+E+     ++I T +  L I+PST+ L G E+ L     R  RL +A+  Q+  D+ 
Sbjct: 62  NVLVEDLKPKDVIIPTKVEGLHILPSTIQLAGAEIELVPTISREVRLKRAIE-QVKEDYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ A+DS+L+P+QCE++ALEGLSQLL TV  V++ +N+ L+I+G
Sbjct: 121 YIIIDCPPSLGLLTINSLTASDSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNNELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KV+ T+IPRNVR+ EAPS+G+P I YD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFREKVFKTIIPRNVRLGEAPSHGEPIITYDPKSRGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E++
Sbjct: 241 VYIDLAKEVM 250


>gi|289523966|ref|ZP_06440820.1| sporulation initiation inhibitor protein Soj [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289502622|gb|EFD23786.1| sporulation initiation inhibitor protein Soj [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 263

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 177/248 (71%), Gaps = 2/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTT+ +NL+ AL   G  VL+ DLDPQG++++GLGI+      S YD
Sbjct: 8   RIIAVANQKGGVGKTTSCVNLAAALGDRGRRVLVADLDPQGHSTSGLGIDKGKLSRSVYD 67

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI + + ++++  T    + ++P+ ++L G E+ L G   R  RL KALS     DF  
Sbjct: 68  VLINDSSPDEVVSSTPWKGVYLLPARLELAGAEVELVGLLSRETRLAKALS--RLKDFDL 125

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AA++++VP+QCE++ALEGLSQL+ TVE VRR +N  L I G+
Sbjct: 126 ILIDCPPSLGLLTVNALVAAETVVVPIQCEYYALEGLSQLVGTVELVRRHLNERLHIGGV 185

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ILTM+DSR +LS++V  +VRK     V+ T IPRNVR+SEAPSYG+P I YD +C G++A
Sbjct: 186 ILTMYDSRTNLSKEVAEEVRKRFSDAVFETTIPRNVRLSEAPSYGQPVIYYDPQCIGAKA 245

Query: 247 YLKLASEL 254
           Y+ LA E+
Sbjct: 246 YMALAEEV 253


>gi|261250650|ref|ZP_05943225.1| ATPase involved in chromosome partitioning [Vibrio orientalis CIP
           102891]
 gi|260939219|gb|EEX95206.1| ATPase involved in chromosome partitioning [Vibrio orientalis CIP
           102891]
          Length = 257

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT INL+ ++AA    VL+IDLDPQGNA+   G++ Y    S+Y+
Sbjct: 3   KIVAIANQKGGVGKTTTCINLAASMAATKRKVLVIDLDPQGNATMASGVDKYQVDASAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+E+    +++ +    +  +I +  D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVEDVPFEEVVCRKTSGHYDLIAANGDVTAAEIKLMEVFAREVRLKHALA-SVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+NAMAAADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNLLTINAMAAADSVLVPMQCEYFALEGLTALMDTISKLAAVVNENLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS +V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD   +G++A
Sbjct: 182 LRTMYDPRNRLSNEVSDQLKKHFGNKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSSGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++++E
Sbjct: 242 YLALAGEMLRRE 253


>gi|222053562|ref|YP_002535924.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. FRC-32]
 gi|221562851|gb|ACM18823.1| Cobyrinic acid ac-diamide synthase [Geobacter sp. FRC-32]
          Length = 257

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 185/252 (73%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +LA   +  LL+D+DPQGNA +G+GI+  + + + YD
Sbjct: 3   KIICIANQKGGVGKTTTSVNLAASLAVAEKRTLLVDMDPQGNAGSGVGIDKSNLEATVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI++   ++ +++T+ P L I+P+  +L G E+ L     R  +L  AL+  L   + Y
Sbjct: 63  VLIDDVEPDKAILKTSFPFLDILPANGELAGAELELVSIIGRELKLKHALA-PLVQAYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N+M AA+S+L+PLQCEF+A+EGLS +L+T+  V++ +N +L I+GI
Sbjct: 122 ILIDCPPSLGLLTVNSMTAAESVLIPLQCEFYAMEGLSHILKTITLVQKGLNPSLRIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+RN+LS QV  ++R +   + + TV+PRNVR+SEAPS+GKP I+YD+   G+ +
Sbjct: 182 LLTMFDARNNLSHQVSEEIRNHFKKETFTTVVPRNVRLSEAPSHGKPIILYDITSRGATS 241

Query: 247 YLKLASELIQQE 258
           Y+ LA E+I +E
Sbjct: 242 YMDLAKEIISRE 253


>gi|332687256|ref|YP_004457030.1| chromosome (plasmid) partitioning protein ParA/ sporulation
           initiation inhibitor protein Soj [Melissococcus
           plutonius ATCC 35311]
 gi|332371265|dbj|BAK22221.1| chromosome (plasmid) partitioning protein ParA/ sporulation
           initiation inhibitor protein Soj [Melissococcus
           plutonius ATCC 35311]
          Length = 253

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA + + VLLID+D QGNA++G+GI   D  +  Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGACLAHLNKKVLLIDIDAQGNATSGIGISKPDVVHDVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E+ I+ ++ +T   NL I+P+T+ L G E+ L     R  RL  A++ ++  DF 
Sbjct: 62  DVLINEEPISSVIQKTQRQNLFIVPATIQLAGAEIELTAMMARESRLKMAIN-EIKDDFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS   +T+N+  A+DSIL+P+QCE++ALEGLSQLL T+  V++  N  L I+G
Sbjct: 121 YILVDCPPSLGHMTINSFTASDSILIPVQCEYYALEGLSQLLNTIRLVQKHFNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VRK    KVYNT+IPRNVR+SEAPS+G P I YD +  G++
Sbjct: 181 VLLTMYDARTNLGAEVVEEVRKYFREKVYNTIIPRNVRLSEAPSHGVPIIDYDPRSRGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E+++ E
Sbjct: 241 VYQALAKEVLENE 253


>gi|323144401|ref|ZP_08079009.1| sporulation initiation inhibitor protein Soj [Succinatimonas hippei
           YIT 12066]
 gi|322415854|gb|EFY06580.1| sporulation initiation inhibitor protein Soj [Succinatimonas hippei
           YIT 12066]
          Length = 255

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/253 (50%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT +NL+ +LA++ + VL+ID DPQGNA+   GI  ++ K +  
Sbjct: 2   SKIIAIANQKGGVGKTTTCVNLAASLASLQKRVLVIDSDPQGNATMASGINKFELKKTIC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI+  +I   LI+       +IP+  DL   E+ L     R FRL  AL+  +  ++ 
Sbjct: 62  QVLIDGMDIRDCLIEETNGAFHLIPANEDLTAAEVKLLDYLAREFRLKNALN-DIKDNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS NLLT+NAM AADSILVPLQCE+FALEGL+ L++TV+++   VN  L I+G
Sbjct: 121 YIFIDCPPSLNLLTVNAMCAADSILVPLQCEYFALEGLTLLIDTVDQLAHAVNPKLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TMFD+RN LS  V  ++++N    VY T+IPRNVR++EAPS+GKPA+ YD    GS+
Sbjct: 181 ILRTMFDNRNRLSSDVSDELKRNFDTLVYETIIPRNVRLAEAPSFGKPAMYYDKSSMGSK 240

Query: 246 AYLKLASELIQQE 258
           AY+ LA E++Q++
Sbjct: 241 AYMALAHEMLQKD 253


>gi|119471636|ref|ZP_01614021.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonadales bacterium TW-7]
 gi|119445415|gb|EAW26702.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonadales bacterium TW-7]
          Length = 261

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 181/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGVGKTTTA+NL+ ++AA    VLLIDLDPQGNA+ G G++ Y    + Y
Sbjct: 2   AKVIALANQKGGVGKTTTAVNLAASMAATKRKVLLIDLDPQGNATMGSGVDKYGDVPTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE+K I  ++I+       +I +  D+   E+ L     R  RL  AL  ++   + 
Sbjct: 62  DLLIEDKPIEDVIIKETSGEYHMIAANGDVTAAEVKLMELFAREVRLRNALE-KIQDQYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N+LT+NAMAAADSILVP+QCE++ALEGL+ L++T+ ++ + VN  L I+G
Sbjct: 121 FIFIDCPPSLNMLTVNAMAAADSILVPMQCEYYALEGLTALMDTITQLAKLVNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDRASSGAK 240

Query: 246 AYLKLASELIQQE 258
           AYL LA E+++++
Sbjct: 241 AYLALAGEMLRRK 253


>gi|296114342|ref|ZP_06832996.1| Cobyrinic acid ac-diamide synthase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295979103|gb|EFG85827.1| Cobyrinic acid ac-diamide synthase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 275

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINL+  LAA G  VLLID+DPQGNASTGLGI   +R+  +Y 
Sbjct: 13  RIIALANQKGGVGKTTTAINLAAGLAAGGFRVLLIDIDPQGNASTGLGIGYENRRRGTYA 72

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+ E+     ++ +T++P LS+I +  +L G E+ L     R +RL  A++ ++  ++  
Sbjct: 73  LIGEDAPAADLIQETSVPGLSVIAADTELAGAELELVMSDRREYRLRDAIA-RIGGEYDV 131

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AA +++VPLQCEFFALEG+SQL+ TV  + +++N AL ++GI
Sbjct: 132 ILIDCPPSLGLLTLNALVAAQAVIVPLQCEFFALEGISQLVRTVNSLCKSLNPALKLEGI 191

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D RN+LS+ V +D R   G +V  TVIPRN+RISEA S+G+  + YD + +GSQA
Sbjct: 192 VLTMYDRRNNLSELVAADARSFFGDRVLETVIPRNIRISEAQSHGQAVMFYDARSSGSQA 251

Query: 247 YLKLASELIQQ 257
           Y  L+ E+  +
Sbjct: 252 YRALSDEVTSR 262


>gi|227550628|ref|ZP_03980677.1| chromosome partitioning ATPase [Enterococcus faecium TX1330]
 gi|257888106|ref|ZP_05667759.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,141,733]
 gi|257896275|ref|ZP_05675928.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium Com12]
 gi|257899262|ref|ZP_05678915.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium Com15]
 gi|293379356|ref|ZP_06625500.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           PC4.1]
 gi|293572709|ref|ZP_06683673.1| ATPase, ParA family [Enterococcus faecium E980]
 gi|227180229|gb|EEI61201.1| chromosome partitioning ATPase [Enterococcus faecium TX1330]
 gi|257824160|gb|EEV51092.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,141,733]
 gi|257832840|gb|EEV59261.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium Com12]
 gi|257837174|gb|EEV62248.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium Com15]
 gi|291607201|gb|EFF36559.1| ATPase, ParA family [Enterococcus faecium E980]
 gi|292641879|gb|EFF60045.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           PC4.1]
          Length = 255

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II++ANQKGGVGKTTT +NL   LA++G+ VLL+D+D QGNA++G+GI   D     Y
Sbjct: 2   AQIISVANQKGGVGKTTTTVNLGACLASLGKKVLLVDMDAQGNATSGVGIRKPDVTKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  I++  + T   NLSI+P+T+ L G E+ L     R  RL  +L+ +++S + 
Sbjct: 62  DVLVNELPIDEATLITEHENLSIVPATLQLAGAEIELTSMMARESRLKGSLA-EVSSQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS   LT+N+  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L+I+G
Sbjct: 121 YILIDCPPSLGHLTINSFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VRK    KVY T+IPRN+R+SEAPS+GKP I YD +  G++
Sbjct: 181 VLLTMYDARTNLGNEVVEEVRKYFREKVYETIIPRNIRLSEAPSHGKPIIDYDPRSRGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E++ +E
Sbjct: 241 VYQALAKEVVSRE 253


>gi|291547586|emb|CBL20694.1| ATPases involved in chromosome partitioning [Ruminococcus sp.
           SR1/5]
          Length = 255

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGK+TTAINLS  LA  G+ VL ID+DPQGN ++GLG +    + + Y+
Sbjct: 3   RIIAVANQKGGVGKSTTAINLSACLAEKGKKVLAIDIDPQGNTTSGLGADKNAVENTLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E      +I+  + N+ +IPS M+L G E+ L   +D+ F L K ++ +L   + Y
Sbjct: 63  LLLGEAETKDTIIKNVVDNVDLIPSNMNLSGAEIELVDLEDKEFIL-KKITDKLRRKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NA+ AA S+LVP+QCE++ALEGLSQL+ T+E VR  +N  L I+G+
Sbjct: 122 IIMDCPPSLSMLTINALTAATSVLVPIQCEYYALEGLSQLIHTIELVRDRLNKRLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRNVR++EAPSYGKP  +YD +  G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLDQNIYKTIIPRNVRLAEAPSYGKPINLYDSRSTGAES 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I +E
Sbjct: 242 YRLLAEEVIGRE 253


>gi|254515878|ref|ZP_05127938.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR5-3]
 gi|219675600|gb|EED31966.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR5-3]
          Length = 264

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 179/259 (69%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTT +NL+ +LAA+ + VLL+DLDPQGNAS G G++ Y    S+Y
Sbjct: 2   ARIIAIANQKGGVGKTTTCVNLAASLAAMRKRVLLVDLDPQGNASMGSGVDKYSLTRSTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L++   I+  +         ++P+  D+   E+ L     R  RL  AL  Q+   + 
Sbjct: 62  DVLVQACAISDAIQTPPESGFDVLPANGDVTAAEVELIQVDGRERRLRAALG-QVQGSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS NLLT+N + AAD +++ +QCE+FALEGLS LL+TVE+VR +VN  L+++G
Sbjct: 121 YILIDCPPSLNLLTLNGLVAADGVMIAMQCEYFALEGLSALLDTVEQVRSSVNIGLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+  V   + ++ G KVY TVIPRN+R++EAPS+G PA+ YD    GS+
Sbjct: 181 ILRTMYDPRNSLTNAVSGQLHEHFGDKVYRTVIPRNIRLAEAPSHGVPAMHYDKYSRGSR 240

Query: 246 AYLKLASELIQQERHRKEA 264
           AY+ LA E+I++E   + A
Sbjct: 241 AYMALAGEMIRREERLRSA 259


>gi|69247497|ref|ZP_00604367.1| Cobyrinic acid a,c-diamide synthase [Enterococcus faecium DO]
 gi|257878637|ref|ZP_05658290.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,230,933]
 gi|257881303|ref|ZP_05660956.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,502]
 gi|257885578|ref|ZP_05665231.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,501]
 gi|257890520|ref|ZP_05670173.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,410]
 gi|257893096|ref|ZP_05672749.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,408]
 gi|258615279|ref|ZP_05713049.1| ParaA family ATPase [Enterococcus faecium DO]
 gi|260558218|ref|ZP_05830414.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium C68]
 gi|261206908|ref|ZP_05921597.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium TC 6]
 gi|289567293|ref|ZP_06447672.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium D344SRF]
 gi|293563242|ref|ZP_06677694.1| ATPase, ParA family protein [Enterococcus faecium E1162]
 gi|293569168|ref|ZP_06680474.1| ATPase, ParA family protein [Enterococcus faecium E1071]
 gi|294616668|ref|ZP_06696439.1| ATPase, ParA family [Enterococcus faecium E1636]
 gi|294619736|ref|ZP_06699141.1| ParA-like chromosome partitioning ATPase [Enterococcus faecium
           E1679]
 gi|294623750|ref|ZP_06702578.1| ATPase, ParA family [Enterococcus faecium U0317]
 gi|314940140|ref|ZP_07847320.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133a04]
 gi|314943029|ref|ZP_07849833.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133C]
 gi|314948147|ref|ZP_07851543.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0082]
 gi|314953439|ref|ZP_07856357.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133A]
 gi|314993822|ref|ZP_07859158.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133B]
 gi|314998153|ref|ZP_07863035.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133a01]
 gi|68194822|gb|EAN09297.1| Cobyrinic acid a,c-diamide synthase [Enterococcus faecium DO]
 gi|257812865|gb|EEV41623.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,230,933]
 gi|257816961|gb|EEV44289.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,502]
 gi|257821434|gb|EEV48564.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,501]
 gi|257826880|gb|EEV53506.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,410]
 gi|257829475|gb|EEV56082.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium
           1,231,408]
 gi|260075392|gb|EEW63698.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium C68]
 gi|260078536|gb|EEW66238.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium TC 6]
 gi|289160912|gb|EFD08833.1| cobyrinic acid a,c-diamide synthase [Enterococcus faecium D344SRF]
 gi|291588137|gb|EFF19979.1| ATPase, ParA family protein [Enterococcus faecium E1071]
 gi|291590488|gb|EFF22226.1| ATPase, ParA family [Enterococcus faecium E1636]
 gi|291594006|gb|EFF25475.1| ParA-like chromosome partitioning ATPase [Enterococcus faecium
           E1679]
 gi|291596704|gb|EFF27927.1| ATPase, ParA family [Enterococcus faecium U0317]
 gi|291604781|gb|EFF34263.1| ATPase, ParA family protein [Enterococcus faecium E1162]
 gi|313587865|gb|EFR66710.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133a01]
 gi|313591713|gb|EFR70558.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133B]
 gi|313594542|gb|EFR73387.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133A]
 gi|313598229|gb|EFR77074.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133C]
 gi|313640645|gb|EFS05225.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0133a04]
 gi|313645401|gb|EFS09981.1| sporulation initiation inhibitor protein Soj [Enterococcus faecium
           TX0082]
          Length = 255

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II++ANQKGGVGKTTT +NL   LA++G+ VLL+D+D QGNA++G+GI   D     Y
Sbjct: 2   AQIISVANQKGGVGKTTTTVNLGACLASLGKKVLLVDMDAQGNATSGVGIRKPDVTRDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  I++  + T   NLSI+P+T+ L G E+ L     R  RL  +L+ +++S + 
Sbjct: 62  DVLVNELPIDEATLITEHENLSIVPATLQLAGAEIELTSMMARESRLKGSLA-EVSSQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS   LT+N+  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L+I+G
Sbjct: 121 YILIDCPPSLGHLTINSFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VRK    KVY T+IPRN+R+SEAPS+GKP I YD +  G++
Sbjct: 181 VLLTMYDARTNLGNEVVEEVRKYFREKVYETIIPRNIRLSEAPSHGKPIIDYDPRSRGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E++ +E
Sbjct: 241 VYQALAKEVVSRE 253


>gi|109900602|ref|YP_663857.1| cobyrinic acid a,c-diamide synthase [Pseudoalteromonas atlantica
           T6c]
 gi|109702883|gb|ABG42803.1| chromosome segregation ATPase [Pseudoalteromonas atlantica T6c]
          Length = 278

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 126/257 (49%), Positives = 181/257 (70%), Gaps = 3/257 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTA+N++ ++AA    VLLIDLDPQGNA+ G G++ YD   + Y+
Sbjct: 19  KVIAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDAPNTCYE 78

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIEEK I  ++I        +I +  D+   E+ L     R  RL  AL+  + + + +
Sbjct: 79  LLIEEKPIKDVVISDTSGKYDLIAANTDVTAAEIKLMEVFAREVRLRNALA-PVRNYYDF 137

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N LT+NAMAAADS+LVP+QCE++ALEGL+ L++T++++   VN  L I+G+
Sbjct: 138 IFIDCPPSLNQLTVNAMAAADSVLVPMQCEYYALEGLTALMDTIKKLASVVNPELTIEGV 197

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G +VY TVIPRNVR++EAPS+G PA+ YD    GS+A
Sbjct: 198 LRTMYDPRNRLANDVSEQLKRHFGEQVYRTVIPRNVRLAEAPSFGTPAMYYDRSSTGSKA 257

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+++  R +KE
Sbjct: 258 YLALAGEILR--RSKKE 272


>gi|258543705|ref|YP_003189138.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634783|dbj|BAI00759.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637839|dbj|BAI03808.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640893|dbj|BAI06855.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643948|dbj|BAI09903.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-22]
 gi|256647003|dbj|BAI12951.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-26]
 gi|256650056|dbj|BAI15997.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-32]
 gi|256653046|dbj|BAI18980.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256656100|dbj|BAI22027.1| chromosome partitioning protein ParA [Acetobacter pasteurianus IFO
           3283-12]
          Length = 265

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 176/254 (69%), Gaps = 1/254 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K   +  +ANQKGGVGKTTTAINL+ +LAA G  V+L+D+DPQGNASTGLG++   RK  
Sbjct: 9   KACHVFAVANQKGGVGKTTTAINLAASLAADGAKVVLLDMDPQGNASTGLGVDYDSRKGG 68

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           SY LL+ EK  + +L  T I NLS+I +  +L+G E+ L   + R  RL  AL   L   
Sbjct: 69  SYALLMHEKAADDLLQPTEIDNLSVIAANTELVGAEIELVDAEHRETRLRTALE-PLRET 127

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             ++ +DCPPS  LLT+N+  AAD +L PLQCEFFALEGL  L++T+  V++ +N  L +
Sbjct: 128 VDFVIIDCPPSLGLLTLNSFVAADGVLAPLQCEFFALEGLGHLVKTIGRVQKNLNPELKM 187

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            GI+LTM+D RN+LS+ V +D R   G  V  TVIPRN+RISEA S+G+P ++YD + +G
Sbjct: 188 AGIVLTMYDRRNNLSELVAADARSFFGKDVLETVIPRNIRISEAQSHGQPVMLYDSRASG 247

Query: 244 SQAYLKLASELIQQ 257
           + AY  LA+E++++
Sbjct: 248 TTAYQALAAEVMKR 261


>gi|117619690|ref|YP_858688.1| Soj protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561097|gb|ABK38045.1| Soj protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 267

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 181/257 (70%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ ++AA    VL+IDLDPQGNA+ G G++ YD + ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYDVERTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIE+  I +++I        +I +  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLIEDAPIGEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNALA-SVRDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           +F+DCPPS N+LT+NAMAAADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 VFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPELKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+  V   ++++ G KVY T+IPRNVR++EAPS+G PA+ YD    G++A
Sbjct: 182 LRTMFDHRNRLANDVSDQLKQHFGDKVYRTIIPRNVRLAEAPSFGAPAMHYDKSSVGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+++++   ++
Sbjct: 242 YLALAGEILRRQEQERQ 258


>gi|310817160|ref|YP_003965124.1| chromosome partitioning protein ParA [Ketogulonicigenium vulgare
           Y25]
 gi|308755895|gb|ADO43824.1| chromosome partitioning protein ParA [Ketogulonicigenium vulgare
           Y25]
          Length = 254

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/253 (54%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTTAINL+ ALA     VLLIDLDPQGNASTG GI    R  ++Y
Sbjct: 2   SKIIAIANQKGGVGKTTTAINLAAALAENARRVLLIDLDPQGNASTGFGITPDQRDTTTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+++ E ++     +TA  N+ ++P+T DL   ++ +  ++ R F L   L   +++ F 
Sbjct: 62  DVILGEASLAAATQKTAFENIWLVPATTDLSSADIAVVDDERRSFLLRDRLRGAVSA-FD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS N+LT+NAM AA S+LVPLQ EFFALEGLSQL+ TV EVR   N+ L I+G
Sbjct: 121 YVLIDCPPSLNILTINAMVAAHSVLVPLQSEFFALEGLSQLMLTVREVRSVANADLRIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I LTM+D RN+LS QV +D R NLG  V+ TVIPRNVR+SEAPS+  P + YD    G++
Sbjct: 181 IALTMYDKRNNLSLQVEADARDNLGELVFRTVIPRNVRLSEAPSFAMPVLSYDPTSTGAE 240

Query: 246 AYLKLASELIQQE 258
           AY +LA ELI +E
Sbjct: 241 AYRRLAEELIARE 253


>gi|163745108|ref|ZP_02152468.1| chromosome partitioning protein ParA [Oceanibulbus indolifex
           HEL-45]
 gi|161381926|gb|EDQ06335.1| chromosome partitioning protein ParA [Oceanibulbus indolifex
           HEL-45]
          Length = 244

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 176/241 (73%), Gaps = 2/241 (0%)

Query: 18  VGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQI 77
           +GKTTT INL+ ALA  G+ +L++DLDPQGNASTGLGIE+ DR++++Y+LL+++    Q+
Sbjct: 1   MGKTTTTINLAAALAETGKRILVVDLDPQGNASTGLGIEVEDREFTTYELLLDDVEPQQV 60

Query: 78  LIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL-SVQLTS-DFSYIFLDCPPSF 135
           + +T    L IIP+T+DL   ++ L   + R F L  AL   Q+ + +  YI +DCPPS 
Sbjct: 61  IQKTETEGLMIIPATVDLSSADIELFSNEKRSFLLHDALRQTQMDAFELDYILIDCPPSL 120

Query: 136 NLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRN 195
           NLLT+NAM AA S+LVPLQ EFFALEGLSQL+ T+ EVR++ N  L I+G++LTM+D RN
Sbjct: 121 NLLTVNAMIAAHSVLVPLQSEFFALEGLSQLMLTIREVRQSGNKDLRIEGVLLTMYDKRN 180

Query: 196 SLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELI 255
           +LSQQV +D R NLG  V+ TVIPRNVR+SEAPS+  P I YD    G+ AY  LA+EL 
Sbjct: 181 NLSQQVENDARANLGELVFQTVIPRNVRVSEAPSFAMPVISYDPTSKGAVAYRDLAAELT 240

Query: 256 Q 256
           +
Sbjct: 241 R 241


>gi|325265453|ref|ZP_08132176.1| sporulation initiation inhibitor protein Soj [Clostridium sp. D5]
 gi|324029311|gb|EGB90603.1| sporulation initiation inhibitor protein Soj [Clostridium sp. D5]
          Length = 255

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS++LA +G+ VL +D+DPQGN ++GL +   + + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTAINLSSSLAGLGKKVLALDMDPQGNMTSGLSVNKNEVENTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I    I + +      NL ++PS +DL   E+ L G  ++ + +   +  ++  D+ Y
Sbjct: 63  LIIGGAEIEECICSEVFENLDVLPSNIDLSAAEIELIGVDNKEYIIKNEIE-KVKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ ++LT+NAM  ADS+LVP+QCE++ALEGLSQL+ T+E V+  +N +L+I+G+
Sbjct: 122 VIIDCPPALSMLTINAMTTADSVLVPIQCEYYALEGLSQLVHTIELVQERLNPSLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P  +YD K AG+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNIRLAEAPSYGMPINLYDPKSAGAES 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMMLAEEVINK 252


>gi|119947332|ref|YP_945012.1| cobyrinic acid a,c-diamide synthase [Psychromonas ingrahamii 37]
 gi|119865936|gb|ABM05413.1| chromosome segregation ATPase [Psychromonas ingrahamii 37]
          Length = 257

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 178/252 (70%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT +N++ ++AA   NVL+IDLDPQGNA+ G G++ Y+  +S+YD
Sbjct: 3   KIIAIANQKGGVGKTTTCVNIAASIAATKRNVLVIDLDPQGNATMGSGVDKYEVAHSAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI+E  ++Q++         +I +  D+   E+ L     R  RL  AL+     ++ Y
Sbjct: 63  LLIDELPLDQVVQVETTGGYHLIAANSDVTAAEVKLMEYFARETRLRSALA-DYKDNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM AADS+L+P+QCE++ALEGL+ LL+T+ ++   VNS L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMTAADSVLIPMQCEYYALEGLTALLDTISKLASVVNSGLKIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L   V   ++K+ G KVY T+IPRN+R++EAPS+  P + YD    G++A
Sbjct: 182 LRTMYDPRNRLCSDVSDQLKKHFGEKVYRTIIPRNIRLAEAPSFSTPVMYYDKNSTGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA+E+++QE
Sbjct: 242 YLALAAEILRQE 253


>gi|126463648|ref|YP_001044762.1| cobyrinic acid a,c-diamide synthase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105312|gb|ABN77990.1| chromosome segregation ATPase [Rhodobacter sphaeroides ATCC 17029]
          Length = 274

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 179/252 (71%), Gaps = 2/252 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K  I+ IANQKGGVGKTTTAINL+  LA +G  +L++DLDPQGNASTGLGIE  DR  +S
Sbjct: 9   KPLILAIANQKGGVGKTTTAINLAAGLAELGARILVVDLDPQGNASTGLGIEAPDRLKTS 68

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS-- 122
           YDLL++  +++++++ T   NL I P+  DL   ++ L   + R   L +AL  Q     
Sbjct: 69  YDLLLDRPDLDEVVLPTRTDNLFICPANADLASADIELAVNEKRSQLLREALRQQGMERF 128

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F YI +DCPPS +LLT+NA+ A DS+LVPLQ EFFALEGLSQL+ T+ EVR T N AL 
Sbjct: 129 GFDYILIDCPPSLSLLTVNALIACDSVLVPLQSEFFALEGLSQLMLTIREVRGTANPALK 188

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+G++LTM+D RN+LSQ V  D R+NLG  V+ T+IPRNVR+SEAPSY  P + YD    
Sbjct: 189 IEGVLLTMYDKRNNLSQLVEGDARQNLGDLVFRTMIPRNVRVSEAPSYALPVLSYDPTSK 248

Query: 243 GSQAYLKLASEL 254
           GS+AY  LA E+
Sbjct: 249 GSEAYRALAREI 260


>gi|77464805|ref|YP_354309.1| chromosome segregation ATPase [Rhodobacter sphaeroides 2.4.1]
 gi|332559701|ref|ZP_08414023.1| chromosome segregation ATPase [Rhodobacter sphaeroides WS8N]
 gi|77389223|gb|ABA80408.1| chromosome segregation ATPase [Rhodobacter sphaeroides 2.4.1]
 gi|332277413|gb|EGJ22728.1| chromosome segregation ATPase [Rhodobacter sphaeroides WS8N]
          Length = 274

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 179/252 (71%), Gaps = 2/252 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K  I+ IANQKGGVGKTTTAINL+  LA +G  +L++DLDPQGNASTGLGIE  DR  +S
Sbjct: 9   KPLILAIANQKGGVGKTTTAINLAAGLAELGARILVVDLDPQGNASTGLGIEAPDRLKTS 68

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS-- 122
           YDLL++  +++++++ T   NL I P+  DL   ++ L   + R   L +AL  Q     
Sbjct: 69  YDLLLDRPDLDEVVLPTRTDNLFICPANADLASADIELAVNEKRSQLLREALRQQGMERF 128

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            F YI +DCPPS +LLT+NA+ A DS+LVPLQ EFFALEGLSQL+ T+ EVR T N AL 
Sbjct: 129 GFDYILIDCPPSLSLLTVNALIACDSVLVPLQSEFFALEGLSQLMLTIREVRGTANPALK 188

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+G++LTM+D RN+LSQ V  D R+NLG  V+ T+IPRNVR+SEAPSY  P + YD    
Sbjct: 189 IEGVLLTMYDKRNNLSQLVEGDARQNLGDLVFRTMIPRNVRVSEAPSYALPVLSYDPTSK 248

Query: 243 GSQAYLKLASEL 254
           GS+AY  LA E+
Sbjct: 249 GSEAYRALAREI 260


>gi|329113880|ref|ZP_08242651.1| Chromosome partitioning protein ParA [Acetobacter pomorum DM001]
 gi|326696890|gb|EGE48560.1| Chromosome partitioning protein ParA [Acetobacter pomorum DM001]
          Length = 265

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 176/254 (69%), Gaps = 1/254 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K   +  +ANQKGGVGKTTTAINL+ +LAA G  V+L+D+DPQGNASTGLG++   RK  
Sbjct: 9   KACHVFAVANQKGGVGKTTTAINLAASLAADGAKVVLLDMDPQGNASTGLGVDYDSRKGG 68

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           SY LL+ EK  + +L  T I NLS+I +  +L+G E+ L   + R  RL  AL   L   
Sbjct: 69  SYALLMHEKVADDLLQPTEIENLSVIAANTELVGAEIELVDAEHRETRLRTALE-PLRET 127

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             ++ +DCPPS  LLT+N+  AAD +L PLQCEFFALEGL  L++T+  V++ +N  L +
Sbjct: 128 VDFVIIDCPPSLGLLTLNSFVAADGVLAPLQCEFFALEGLGHLVKTIGRVQKNLNPELKM 187

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            GI+LTM+D RN+LS+ V +D R   G  V  TVIPRN+RISEA S+G+P ++YD + +G
Sbjct: 188 AGIVLTMYDRRNNLSELVAADARSFFGKDVLETVIPRNIRISEAQSHGQPVMLYDSRASG 247

Query: 244 SQAYLKLASELIQQ 257
           + AY  LA+E++++
Sbjct: 248 TTAYQALAAEVMKR 261


>gi|83591332|ref|YP_431341.1| chromosome segregation ATPase [Moorella thermoacetica ATCC 39073]
 gi|83574246|gb|ABC20798.1| chromosome segregation ATPase [Moorella thermoacetica ATCC 39073]
          Length = 253

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 184/250 (73%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +++ IANQKGGVGKTTTA+NLS  +A  G  VLL+D+DPQGNA++GLG++ +  ++  Y
Sbjct: 2   GKVLAIANQKGGVGKTTTAVNLSAFIAQEGLKVLLVDIDPQGNATSGLGVDRFKIEHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I    +  ++  TAI NL ++P+T++L G E+ L     R  +L++AL  ++ + + 
Sbjct: 62  DVIINGAPLGSVITATAITNLDLVPATIELAGAEVELATAIAREQKLNRALD-EVRTRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AA  +++P+QCE++ALEGL QL+ T+  V R +N +L+++G
Sbjct: 121 YIIIDCPPSLGLLTLNALTAAGGVIIPIQCEYYALEGLGQLMNTIHLVARHLNPSLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QVV +V+K+   KV+ ++IPRNVR+SEAPSYG+P  +YD +  G++
Sbjct: 181 VVLTMFDPRTNLSLQVVDEVKKHFPEKVFKSIIPRNVRLSEAPSYGQPINLYDPRSRGAE 240

Query: 246 AYLKLASELI 255
           AY +LA E+I
Sbjct: 241 AYQELAREVI 250


>gi|148266266|ref|YP_001232972.1| cobyrinic acid a,c-diamide synthase [Geobacter uraniireducens Rf4]
 gi|146399766|gb|ABQ28399.1| chromosome segregation ATPase [Geobacter uraniireducens Rf4]
          Length = 257

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 185/256 (72%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTT++NL+ +LA      LL+D+DPQGNA +G+GI+  +   + Y
Sbjct: 2   AKIICIANQKGGVGKTTTSVNLAASLAVAERRTLLVDMDPQGNAGSGVGIDKRNLAETVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI++ +   I+++T+ P L I+P+  DL G E+ L     R  +L  AL+  L   + 
Sbjct: 62  DALIDDADAAGIVLKTSFPYLDILPANSDLAGAELELVSIIGRELKLKHALAA-LVDSYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NAM AA+S+L+PLQCEF+A+EGLSQ+L+T+  V++ +N +L I+G
Sbjct: 121 YILIDCPPSLGLLTVNAMTAAESVLIPLQCEFYAMEGLSQILKTIGLVQKGLNPSLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD+RN+LS QV  ++R +   + + TV+PRNVR+SEAPS+GKP I+YD+   G+ 
Sbjct: 181 ILLTMFDARNNLSHQVSEEIRSHFKKETFTTVVPRNVRLSEAPSHGKPIILYDITSRGAT 240

Query: 246 AYLKLASELIQQERHR 261
           +Y+ LA E+I +E H 
Sbjct: 241 SYMDLAKEIIGREVHH 256


>gi|293376419|ref|ZP_06622653.1| sporulation initiation inhibitor protein Soj [Turicibacter
           sanguinis PC909]
 gi|325839305|ref|ZP_08166771.1| sporulation initiation inhibitor protein Soj [Turicibacter sp.
           HGF1]
 gi|292644975|gb|EFF63051.1| sporulation initiation inhibitor protein Soj [Turicibacter
           sanguinis PC909]
 gi|325490587|gb|EGC92902.1| sporulation initiation inhibitor protein Soj [Turicibacter sp.
           HGF1]
          Length = 255

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II I NQKGGVGKTT++INLS +LA +G  VLL+D+DPQ NASTG+G+   D + + +D
Sbjct: 3   KIIAITNQKGGVGKTTSSINLSASLAHLGHKVLLVDMDPQANASTGIGVYKGDAELTVFD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++E   NQ++++T   NL +IPS+ +L G E ++  EK+R F+L   L  Q+   F Y
Sbjct: 63  LLVDEIPTNQVILKTNEENLFLIPSSQELAGFEAMIVMEKEREFKLLPKLE-QVKDYFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA++AADS L+P+QCE++ALEGL+QLL T+  V+R +N  L I+G+
Sbjct: 122 IIIDCPPSLGLLTINALSAADSTLIPVQCEYYALEGLTQLLNTIRIVQRRLNRNLSIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D R  L   V+++V+     KV+NT+IPR VR+SEAPS+GK  I YD K + +Q 
Sbjct: 182 LLTMLDRRTRLGLDVINEVKLYFKEKVFNTIIPRLVRLSEAPSFGKSIIAYDEKSSAAQF 241

Query: 247 YLKLASELIQ 256
           Y+ LA E+++
Sbjct: 242 YVDLAKEVVK 251


>gi|253997703|ref|YP_003049767.1| Cobyrinic acid ac-diamide synthase [Methylotenera mobilis JLW8]
 gi|253984382|gb|ACT49240.1| Cobyrinic acid ac-diamide synthase [Methylotenera mobilis JLW8]
          Length = 269

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ I NQKGGVGKTTT +NL+ +LA++G+ VLLIDLDPQGNASTG GI+    K S Y 
Sbjct: 14  KILAITNQKGGVGKTTTCVNLAASLASLGKRVLLIDLDPQGNASTGSGIDKAHLKLSIYH 73

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI EK + ++++ +      I PS  +L G E+ L  E  R  RL  A+  +L+ D+  
Sbjct: 74  VLIGEKTLKEVVVSSEKGGFDIAPSNRELAGAEVELVNELARETRLKTAIG-KLSDDYDV 132

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + LDCPP+ NL+T+NA+ AA+++++P+QCE++ALEGLS L+ T+++VR  +N  L+I+G+
Sbjct: 133 VLLDCPPALNLVTVNALTAANAVMIPMQCEYYALEGLSDLVNTIKKVRAHLNPTLEIEGL 192

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + T+FD+RN L+QQV + +  + G KVY TVIPRN+R++EAPSYG P + YD    G+ A
Sbjct: 193 LRTLFDNRNMLAQQVSAQLISHFGDKVYKTVIPRNIRLAEAPSYGVPVLSYDKSSKGAVA 252

Query: 247 YLKLASELIQQE 258
           Y++LA E+  +E
Sbjct: 253 YMELAQEITNRE 264


>gi|114568072|ref|YP_755226.1| sporulation initiation inhibitor protein [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|114339007|gb|ABI69855.1| chromosome segregation ATPase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 260

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 185/259 (71%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTTAINL+ ++A   + VLLID DPQGNAS+GLGI     K   Y
Sbjct: 2   AKIIAIANQKGGVGKTTTAINLAASIALGEQKVLLIDCDPQGNASSGLGINRKRLKNCVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           + L+E     +++  T +  L IIP+T+ L G E+ L   ++R   +  AL   +   + 
Sbjct: 62  NWLVEGLPAKEVITATEVDGLEIIPATIQLAGAEVELATRENREHYMANALK-PIKEAYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIFLDCPPS  LLT+NA+ A++S+L+PLQCE++ALEGLSQL++T+  VR+ +N +L ++G
Sbjct: 121 YIFLDCPPSLGLLTINALVASNSVLIPLQCEYYALEGLSQLMDTILLVRKRLNRSLKLEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I +TMFD R +L+ QVV +V++    ++Y T+IPRNVR+SEAPS+G+PA+IYD +  G++
Sbjct: 181 IAMTMFDGRTNLAIQVVDEVKRYFPKEIYQTIIPRNVRLSEAPSHGQPAVIYDPRSRGAE 240

Query: 246 AYLKLASELIQQERHRKEA 264
            Y +LA E++++ +  K +
Sbjct: 241 EYRELAMEVLERAKKGKRS 259


>gi|315640394|ref|ZP_07895507.1| sporulation initiation inhibitor protein Soj [Enterococcus italicus
           DSM 15952]
 gi|315483850|gb|EFU74333.1| sporulation initiation inhibitor protein Soj [Enterococcus italicus
           DSM 15952]
          Length = 254

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 184/254 (72%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL + LA +G+ VLL+D+D QGNA++G+GI   D +   Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGSCLAYMGQKVLLVDMDAQGNATSGMGIRKPDVEQDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  I   ++ ++  NL I+P+T+ L G E+ L     R  RL  ALS +L +++ 
Sbjct: 62  DVLVNEVPIADAILPSSRENLDIVPATLQLAGAEIELTSMMARESRLKTALS-ELHANYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS   LT+NA  A+D+IL+P+QCE++ALEGLSQLL TV  V++  N +L+I+G
Sbjct: 121 FILIDCPPSLGHLTINAFTASDAILIPVQCEYYALEGLSQLLNTVRLVQKHFNPSLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  +VV +VR+    KVY+TVIPRNVR+SEAPS+G   + YD++  G++
Sbjct: 181 VLLTMFDARTNLGAEVVEEVRRYFQEKVYDTVIPRNVRLSEAPSHGLSIVDYDIRSKGAE 240

Query: 246 AYLKLASELIQQER 259
            Y  LA E++ +E+
Sbjct: 241 VYQALAKEVLAREK 254


>gi|118579022|ref|YP_900272.1| cobyrinic acid a,c-diamide synthase [Pelobacter propionicus DSM
           2379]
 gi|118501732|gb|ABK98214.1| chromosome segregation ATPase [Pelobacter propionicus DSM 2379]
          Length = 257

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRII IANQKGGVGKTTTA+NL+ ALAA     LL+D+DPQGNA++G+G++      + Y
Sbjct: 2   SRIICIANQKGGVGKTTTAVNLAAALAATERPTLLVDIDPQGNATSGVGLDKDGLSQTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI   +   +++ T  P L IIPS  DL G E+ L   + R  +L + L  +L   + 
Sbjct: 62  DALINGVDPRGVVMDTGQPFLHIIPSNADLAGAELELASLEGREQKL-RFLLAELRDQYR 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS NLLT+NAM AA+S+L+PLQCE++A+EGLSQ+L T+  ++R +N  L I+G
Sbjct: 121 YIIIDCPPSLNLLTINAMTAAESVLIPLQCEYYAMEGLSQILHTIRLMQRGLNPFLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD R +L ++V  ++R N  G+V+ TVIPRN+R++EAPS+GKP I YD+   G+ 
Sbjct: 181 ILLTMFDGRGNLGKEVAEEIRSNFPGQVFETVIPRNIRLAEAPSHGKPIIYYDINSRGAV 240

Query: 246 AYLKLASELIQQE 258
           AYLKLA E+IQ+E
Sbjct: 241 AYLKLAREIIQRE 253


>gi|167759567|ref|ZP_02431694.1| hypothetical protein CLOSCI_01924 [Clostridium scindens ATCC 35704]
 gi|167662794|gb|EDS06924.1| hypothetical protein CLOSCI_01924 [Clostridium scindens ATCC 35704]
          Length = 254

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 185/251 (73%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS  LA  G+ VL +D+DPQGN ++GLG++    + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTAINLSACLADKGKKVLAVDMDPQGNMTSGLGLDKEFLEKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++I E +I ++L +  + NL ++P+ +DL   E+ L   +++ F +  ++  ++  ++ +
Sbjct: 63  MIIGESDIEEVLQKETMENLDVLPTNIDLSAAEIELIDVENKEFIVRNSIQ-KIRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS ++LT+NAM  ADS+LVP+QCE++ALEGLSQL+ TVE V+  +N  L+I+G+
Sbjct: 122 VIIDCPPSLSMLTINAMTTADSVLVPIQCEYYALEGLSQLIHTVELVKDRLNPDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P   YD K AGS++
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLQQNIYKTIIPRNIRLAEAPSYGMPINQYDPKSAGSES 241

Query: 247 YLKLASELIQQ 257
           Y++LA E+I +
Sbjct: 242 YMRLADEVISK 252


>gi|220933184|ref|YP_002510092.1| chromosome segregation ATPase [Halothermothrix orenii H 168]
 gi|219994494|gb|ACL71097.1| chromosome segregation ATPase [Halothermothrix orenii H 168]
          Length = 249

 Score =  258 bits (660), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 122/250 (48%), Positives = 179/250 (71%), Gaps = 1/250 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           + I NQKGGVGK+TTA+NL  +++ +G+ VLL+D+DPQGNA++G+ ++  + + S YD+L
Sbjct: 1   MAIVNQKGGVGKSTTAVNLGASISELGKKVLLVDIDPQGNATSGVSLDKSNLEKSIYDVL 60

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           IEE +I + +I T I N  I+P+ +DL G E+ L     R  +L + L   +   + YI 
Sbjct: 61  IEEVDIEESIIPTDITNFHILPANIDLAGAEIELVSMMSRESKLKRVLD-PVKEKYDYIL 119

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AAD +LVP+QCE++ALEGL QL++TV  V++ +NS L+I+G++L
Sbjct: 120 IDCPPSLGLLTLNALTAADGVLVPIQCEYYALEGLGQLIQTVNLVQKNLNSDLEIEGVLL 179

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D+R +LSQQV+ +V+     KVY T+IPRNVR+SEAPS+GKP   YD    G++AY 
Sbjct: 180 TMYDARTNLSQQVIDEVKNYFKNKVYETIIPRNVRLSEAPSFGKPITSYDSASTGAKAYR 239

Query: 249 KLASELIQQE 258
            LA E+   E
Sbjct: 240 NLAKEVTGHE 249


>gi|266620964|ref|ZP_06113899.1| sporulation initiation inhibitor protein Soj [Clostridium hathewayi
           DSM 13479]
 gi|288867386|gb|EFC99684.1| sporulation initiation inhibitor protein Soj [Clostridium hathewayi
           DSM 13479]
          Length = 256

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 186/251 (74%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS  LA  G+ VL +D DPQGNA++GLGIE  +   + YD
Sbjct: 3   RIIAIANQKGGVGKTTTAINLSACLAESGQKVLTVDFDPQGNATSGLGIEKGEIDKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E +I + LI     NL ++PS +DL G E+ L   +++   L   LS ++ +++ +
Sbjct: 63  LLVGECDIEECLISNMQENLDLLPSNVDLAGAEIELLEIENKEALLKTYLS-KIQNNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ AA+++LVP+QCE++ALEGL+Q+L+TV  V++ +N +L+++G+
Sbjct: 122 IIIDCPPSLNLLTINALTAANTVLVPIQCEYYALEGLNQVLKTVNLVKKKLNPSLEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV  V+ NL   +Y T+IPRNVR++EAPS+G P  +YD + AG+++
Sbjct: 182 VFTMYDARTNLSLEVVESVKNNLNQNIYKTIIPRNVRLAEAPSHGMPINLYDSRSAGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA+E+I +
Sbjct: 242 YRLLAAEVISR 252


>gi|254000525|ref|YP_003052588.1| Cobyrinic acid ac-diamide synthase [Methylovorus sp. SIP3-4]
 gi|313202484|ref|YP_004041142.1| cobyrinic acid ac-diamide synthase [Methylovorus sp. MP688]
 gi|253987204|gb|ACT52061.1| Cobyrinic acid ac-diamide synthase [Methylovorus sp. SIP3-4]
 gi|312441800|gb|ADQ85906.1| Cobyrinic acid ac-diamide synthase [Methylovorus sp. MP688]
          Length = 260

 Score =  258 bits (660), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ I NQKGGVGKTTT++NL+ +LAA    VLLIDLDPQGNA+TG GI+    K + Y 
Sbjct: 2   RILAITNQKGGVGKTTTSVNLAASLAATKRRVLLIDLDPQGNATTGSGIDKSAVKNTVYH 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI +K++ +++ ++      + P+  DL G E+ L  E  R  RL  AL++ L  ++ Y
Sbjct: 62  VLIGQKSLKEVIQRSEKGGFDVAPANRDLAGAEVELVSEIAREVRLKNALAL-LDGEYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS +L T+NA+ AA ++++P+QCE++ALEGLS L+ T+++VR  +N  L+I+G+
Sbjct: 121 VLIDCPPSLSLTTVNALTAAHAVMIPMQCEYYALEGLSDLVNTIKKVRAYLNPTLEIEGL 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + T+FD+RN L+QQV +++ K+ G KVY TVIPRNVR++EAPSYG P + YD    G++A
Sbjct: 181 LRTLFDNRNMLAQQVSAELAKHFGDKVYRTVIPRNVRLAEAPSYGVPVLFYDKASKGAKA 240

Query: 247 YLKLASELIQQE 258
           YL LA E+I ++
Sbjct: 241 YLALAGEIINRK 252


>gi|227498811|ref|ZP_03928951.1| parA family ATPase [Acidaminococcus sp. D21]
 gi|226904263|gb|EEH90181.1| parA family ATPase [Acidaminococcus sp. D21]
          Length = 254

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 183/254 (72%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTT+INL+  LA     VLL+DLD QGNA++GLGI+    +   Y
Sbjct: 2   TQIIAIANQKGGVGKTTTSINLAACLANTRTRVLLVDLDSQGNATSGLGIDKNTLEKDMY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   ++++++++T   NLS+ P+TM+L G E+ L  +K+R   L K L  ++   + 
Sbjct: 62  DVLIHGIHMDKVVVETKWKNLSVAPATMNLAGAEIELIEKKNRALSLKKQLD-KVKESYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS +LLT+NA+ AADS+L+P+QCEF+ALEG++QL++TV+ +R T N  L ++G
Sbjct: 121 YVLIDCPPSLSLLTINALTAADSVLIPIQCEFYALEGVTQLIQTVDRIRETSNPNLSVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I++TM D+R +LS  VV+ V ++    +Y T+IPR+VR+ EAPSYG+P I YD KC  S 
Sbjct: 181 IVMTMADTRTNLSNDVVTAVHEHFPDLLYKTMIPRSVRLGEAPSYGEPIIAYDPKCKASD 240

Query: 246 AYLKLASELIQQER 259
           AY  L+ E+ ++ +
Sbjct: 241 AYRALSREVKRRAK 254


>gi|323487696|ref|ZP_08092954.1| sporulation initiation inhibitor protein soj [Planococcus
           donghaensis MPA1U2]
 gi|323398430|gb|EGA91218.1| sporulation initiation inhibitor protein soj [Planococcus
           donghaensis MPA1U2]
          Length = 253

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 180/249 (72%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I IANQKGGVGKTT+++NLS  LA +G+ VLLID+DPQGNA++G+G+   D     Y+
Sbjct: 3   RTIAIANQKGGVGKTTSSVNLSACLAYLGKKVLLIDIDPQGNATSGVGVNKGDVDKCIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI++  +   +++T + NL ++P+T+ L G E+ L     R  RL  AL  ++   + Y
Sbjct: 63  VLIDDIAVKDTIMETKVENLHVVPATISLAGAEIELVSTISREARLKNALE-EVKDMYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ A+D+I++P+QCE++ALEGLSQLL T+  V++ +N  L I G+
Sbjct: 122 IIIDCPPSLGLLTLNSLTASDAIIIPVQCEYYALEGLSQLLSTIRLVQKHLNHDLMIDGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+P IIYD K  G++ 
Sbjct: 182 LLTMLDARTNLGVQVIEEVKKYFQDKVYKTIIPRNVRLSEAPSHGEPIIIYDPKSRGAEV 241

Query: 247 YLKLASELI 255
           YL+LA E+I
Sbjct: 242 YLELAKEVI 250


>gi|293115441|ref|ZP_05791494.2| sporulation initiation inhibitor protein Soj [Butyrivibrio
           crossotus DSM 2876]
 gi|292809904|gb|EFF69109.1| sporulation initiation inhibitor protein Soj [Butyrivibrio
           crossotus DSM 2876]
          Length = 268

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 189/263 (71%), Gaps = 5/263 (1%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           +E    RII +ANQKGGVGKTTT INLS  LA  G+ VL+ID+DPQGN ++GLGI+  + 
Sbjct: 7   VEVNMGRIIAVANQKGGVGKTTTTINLSACLAEQGQKVLVIDVDPQGNTTSGLGIDKNNT 66

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           + + Y+L++ E +I+  + ++ + +L +IPS ++L G E+ L    DR + L K ++  L
Sbjct: 67  ENTVYELMLGEASIDDCIYKSVMDDLDVIPSNVNLAGAEIDLIDIDDREYILKKIVN-SL 125

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
              + +I LDCPPS ++LT+NAM AA+++LVP+QCE++ALEGLSQL+ T+  V++ +N  
Sbjct: 126 KEKYDFILLDCPPSLSMLTVNAMTAANTVLVPIQCEYYALEGLSQLIRTINLVKQKLNPE 185

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           L+I+G++ TM+D+R +LS QVV +V+ NL   VY T+IPRN+R++EAPS+G P  +YD K
Sbjct: 186 LEIEGVVFTMYDARTNLSLQVVENVKANLKQTVYKTIIPRNIRLAEAPSHGLPINLYDSK 245

Query: 241 CAGSQAYLKLASELIQQERHRKE 263
            AG+++Y  LA E+I    HR E
Sbjct: 246 SAGAESYRLLAEEVI----HRGE 264


>gi|325285163|ref|YP_004260953.1| Cobyrinic acid ac-diamide synthase [Cellulophaga lytica DSM 7489]
 gi|324320617|gb|ADY28082.1| Cobyrinic acid ac-diamide synthase [Cellulophaga lytica DSM 7489]
          Length = 257

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 185/255 (72%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y+
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESVEVGTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL   K+ ++ ++ T  PN+ +IPS +DL+ IE+ L  ++ R + + KA+  +L   + Y
Sbjct: 63  LLEHTKSASETIMSTTSPNVDLIPSHIDLVAIEIELVDKEQREYMMRKAIG-ELKDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVVIPIQCEYFALEGLGKLLNTIKSVQKIHNPELDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V+K+    V++T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVKKHFSEMVFDTIIQRNVRLSEAPSYGESIIKYDASSKGAAN 241

Query: 247 YLKLASELIQQERHR 261
           YL LA+E++++ + +
Sbjct: 242 YLNLANEIMKKNKEK 256


>gi|225386367|ref|ZP_03756131.1| hypothetical protein CLOSTASPAR_00111 [Clostridium asparagiforme
           DSM 15981]
 gi|225047549|gb|EEG57795.1| hypothetical protein CLOSTASPAR_00111 [Clostridium asparagiforme
           DSM 15981]
          Length = 256

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII I NQKGGVGKTTTAINLS  LA  G++VLL+D DPQGNAS+GLG+E  D + + Y
Sbjct: 2   ARIIAITNQKGGVGKTTTAINLSACLAEAGQHVLLVDFDPQGNASSGLGLEREDIENTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL EE    +  I     NL I+PS M+L G E+     +D+  +L ++   ++  D+ 
Sbjct: 62  DLLTEEVTFEECRIAEIQKNLDILPSDMNLAGAEIEFQEIEDK-EKLLRSYLEKIKDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS N+LT+NA+ AAD++LVP+QCE++ALEGL Q+L+TV+ V+R +N  L+++G
Sbjct: 121 FILIDCPPSLNILTINALTAADTVLVPIQCEYYALEGLGQVLKTVDLVKRKLNPGLELEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D+R +LS +VV +V+ NL   +Y T+IPRNVR++EAPS+G     YD +  G++
Sbjct: 181 VVFTMYDARTNLSLEVVENVKSNLNRTIYKTIIPRNVRLAEAPSHGMSINQYDTRSTGAE 240

Query: 246 AYLKLASELIQQ 257
           +Y  LA+E++ +
Sbjct: 241 SYRMLAAEVMSR 252


>gi|149182301|ref|ZP_01860780.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. SG-1]
 gi|148849993|gb|EDL64164.1| chromosome partitioning protein; transcriptional regulator
           [Bacillus sp. SG-1]
          Length = 253

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 122/249 (48%), Positives = 178/249 (71%), Gaps = 1/249 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII I NQKGGVGKTTT++NL   LA IG+ VLL+D+DPQGNA++G+GIE  D +   Y
Sbjct: 2   GRIIAITNQKGGVGKTTTSVNLGACLAYIGKKVLLVDIDPQGNATSGVGIEKGDVQECIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+++  +  ++  T +  L  +P+T+ L G E+ L     R  RL +AL  ++  ++ 
Sbjct: 62  DVLVDDAEVKDLVKPTTVERLYAVPATISLAGAEIELVPTISREVRLKRALE-KVKDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL TV  V++ +N  L I G
Sbjct: 121 FIIIDCPPSLGLLTINALTASDAVIIPVQCEYYALEGLSQLLSTVRLVQKHLNHDLMIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRN+R+SEAPS+G+P IIYD K  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQDKVYRTIIPRNIRLSEAPSHGEPIIIYDAKSRGAE 240

Query: 246 AYLKLASEL 254
            YL LA E+
Sbjct: 241 VYLDLAKEV 249


>gi|170729225|ref|YP_001763251.1| cobyrinic acid ac-diamide synthase [Shewanella woodyi ATCC 51908]
 gi|169814572|gb|ACA89156.1| Cobyrinic acid ac-diamide synthase [Shewanella woodyi ATCC 51908]
          Length = 263

 Score =  258 bits (658), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 183/255 (71%), Gaps = 2/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G GI+ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGIDKYSVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++EK+ ++++ +       +I    D+   E+ L     R  RL  AL+  +  ++ +
Sbjct: 63  LLVDEKSFDEVVYRDTSGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PVKDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKIGAMVNPGLCIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLANDVSDQLKQHFGEKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQ-ERH 260
           YL LA E+I++ E+H
Sbjct: 242 YLSLAGEIIRRAEQH 256


>gi|315644286|ref|ZP_07897456.1| Cobyrinic acid ac-diamide synthase [Paenibacillus vortex V453]
 gi|315280661|gb|EFU43950.1| Cobyrinic acid ac-diamide synthase [Paenibacillus vortex V453]
          Length = 253

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAIANQKGGVGKTTTSVNLGAGLASLGKRVLLVDIDPQGNTTSGVGINKADVANCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I E +    +  T I  L IIP+T+ L G E+ L     R  RL K+L + +   + 
Sbjct: 62  DIIINEVHPKDAICGTNIEGLDIIPATIQLAGAEIELVPTISREVRLKKSLQL-IKPQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ AADS+++P+QCE++ALEGLSQLL TV  V++ +N++L I+G
Sbjct: 121 YILIDCPPSLGILTINSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQEKVYRTIIPRNVRLSEAPSHGQSIITYDPRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            YL+LA E+I  E
Sbjct: 241 VYLELAKEVISYE 253


>gi|312136214|ref|YP_004003552.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor owensensis
           OL]
 gi|311776265|gb|ADQ05752.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor owensensis
           OL]
          Length = 263

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ I NQKGGVGKTTT +NLS A++  G+ VL +D DPQGN ++G GI+      ++Y
Sbjct: 2   ARIVAIVNQKGGVGKTTTCVNLSAAISKKGKKVLAVDCDPQGNLTSGFGIDKKSLSRTTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   +  + +I+    NLS++P+ ++L G E+ L     R  RL  A+  ++  ++ 
Sbjct: 62  DVLIGSCSAEEAIIKDKFENLSVLPANVNLAGAEIELVSMIARELRLKDAIE-KIKIEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AADS+++P+QCE++ALEGLSQL  T+  VR+ +N  L+I G
Sbjct: 121 YIFIDCPPSLGLLTLNALVAADSVIIPIQCEYYALEGLSQLSNTISLVRKHLNKRLEIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS +VV +V++  G KV+ +VIPRNVR+SEAPS+G P IIYD    G++
Sbjct: 181 VVLTMFDSRTNLSLEVVEEVKRFFGQKVFLSVIPRNVRLSEAPSFGLPGIIYDPDSKGAK 240

Query: 246 AYLKLASELIQQ 257
           AY++LA E I +
Sbjct: 241 AYIELAEEYINR 252


>gi|297585584|ref|YP_003701364.1| cobyrinic acid ac-diamide synthase [Bacillus selenitireducens
           MLS10]
 gi|297144041|gb|ADI00799.1| Cobyrinic acid ac-diamide synthase [Bacillus selenitireducens
           MLS10]
          Length = 253

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I IANQKGGVGKTTTA+NLS  LA  G+ VL+ID+DPQGN ++G+GIE  D     Y+
Sbjct: 3   RVIAIANQKGGVGKTTTAVNLSAGLAYEGKKVLIIDIDPQGNTTSGIGIEKGDVDECIYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+E+ ++  I++ T   +L I+PST+ L G E+ L     R  RL  A+   +  ++ +
Sbjct: 63  ILVEDSDVKDIILPTNTEHLYIVPSTIQLAGAEIELVPTISREVRLKNAIE-SIRDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ AA+S+L+P+QCE++ALEGLSQLL TV  V++ +N  L+I+G+
Sbjct: 122 IIIDCPPSLGLLTLNSLTAANSVLIPVQCEYYALEGLSQLLNTVRLVQKHLNHDLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD+R +L  QV+ +V+K    KV++T+IPRNVR+SEAPS+G+  I YD +  G++ 
Sbjct: 182 LLTMFDARTNLGIQVIEEVKKYFHEKVFSTIIPRNVRLSEAPSHGESIISYDARSRGAEV 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I  
Sbjct: 242 YIDLAKEVIAH 252


>gi|295398149|ref|ZP_06808198.1| sporulation initiation inhibitor protein Soj [Aerococcus viridans
           ATCC 11563]
 gi|294973668|gb|EFG49446.1| sporulation initiation inhibitor protein Soj [Aerococcus viridans
           ATCC 11563]
          Length = 258

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 184/250 (73%), Gaps = 1/250 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL++ALA  G+ +LLID D QGNA++GLGI     + S YD
Sbjct: 3   KVIAVANQKGGVGKTTTTVNLASALAYQGKKILLIDSDAQGNATSGLGIAKGSVENSIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI E  +   ++ ++  NLS++P+T+ L G E+ L     R  ++ +A+   + +D+ Y
Sbjct: 63  VLINEVAVKDAVVSSSRENLSVVPATISLAGAEVELTSISHREQKMKEAIQ-PIRNDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS   LT+NA  +ADS+L+P+Q E++ALEGLSQLL T++ V++  N++L I+G+
Sbjct: 122 IFIDCPPSLGHLTINAFTSADSVLIPVQSEYYALEGLSQLLNTIQLVQKHFNASLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TM+D+R +LS +VV +VRK  G  VY T+IPRNVR+SEAPSYG+  I YD++  G++ 
Sbjct: 182 LMTMYDARTNLSNEVVEEVRKYFGQAVYTTLIPRNVRLSEAPSYGQSIIDYDIRSRGAEV 241

Query: 247 YLKLASELIQ 256
           YL+LA E+++
Sbjct: 242 YLELAKEVLE 251


>gi|237809876|ref|YP_002894316.1| Cobyrinic acid ac-diamide synthase [Tolumonas auensis DSM 9187]
 gi|237502137|gb|ACQ94730.1| Cobyrinic acid ac-diamide synthase [Tolumonas auensis DSM 9187]
          Length = 263

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 178/258 (68%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT++NL+ ++AA    VLLIDLDPQGNA+   G+  Y+   + Y+
Sbjct: 3   KVIAIANQKGGVGKTTTSVNLAASMAATRRKVLLIDLDPQGNATMASGVNKYETDRTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE  +  ++I        +I +  D    E+ L     R  RL  AL+  +  D+ Y
Sbjct: 63  LLVEEMPVRDVIITETTGGYDLIAANGDATAAEIRLMEVFAREIRLRNALA-PIRDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPALNLLTVNAMSAADSVLVPMQCEYFALEGLTALVDTISKLAAVVNPNLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN LS +V   +++  G KVY T+IPRNVR++EAPS+G P + YD    GS+A
Sbjct: 182 LRTMFDHRNRLSNEVSEQLKQYFGDKVYRTIIPRNVRLAEAPSHGTPVMYYDKSSLGSKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA EL+++E  +++A
Sbjct: 242 YLGLAGELLRREEQQQKA 259


>gi|302880134|ref|YP_003848698.1| cobyrinic acid ac-diamide synthase [Gallionella capsiferriformans
           ES-2]
 gi|302582923|gb|ADL56934.1| cobyrinic acid ac-diamide synthase [Gallionella capsiferriformans
           ES-2]
          Length = 260

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT +NL+ +LAAIG+ VLLIDLDPQGNA+ G GIE  D + + Y 
Sbjct: 3   KIMAIANQKGGVGKTTTTVNLAASLAAIGQRVLLIDLDPQGNATMGSGIEKRDLEMTVYH 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ +K I +    +      ++P+  DL G E+ L    +R  RL  A++ ++  ++ +
Sbjct: 63  VLLGKKTIAESRRTSVAGKYDVLPANRDLAGAEIELIEFLNRETRLRDAIT-KVADEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ NLLT+N + AA S+++P+QCE++ALEGLS L+ T+  VR ++N  L+I+G+
Sbjct: 122 VLIDCPPALNLLTLNGLCAAKSVMIPMQCEYYALEGLSDLVNTIRRVRASLNPVLEIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN+L+QQV   ++ + G KVY+TVIPRNVR++EAPSYG P + +D    G+QA
Sbjct: 182 LRTMFDPRNTLAQQVSDQLQAHFGKKVYSTVIPRNVRLAEAPSYGVPVLYHDKASKGTQA 241

Query: 247 YLKLASELIQQERHRKEAA 265
           YL LASEL+    +  +AA
Sbjct: 242 YLALASELLSIAANSAKAA 260


>gi|37785811|gb|AAR02618.1| Soj [Aeromonas hydrophila]
          Length = 267

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 181/257 (70%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ ++AA    VL+IDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASMAATRRKVLVIDLDPQGNATMGSGVDKYEVERTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIE+  I +++I        +I +  D+   E+ L     R  RL  AL+  +   + Y
Sbjct: 63  LLIEDAPIGEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNALAA-VRDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           +F+DCPPS N+LT+NAMAAADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 VFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPDLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+  V   ++++ G KVY T+IPRNVR++EAPS+G PA+ YD    G++A
Sbjct: 182 LRTMFDHRNRLANDVSDQLKQHFGDKVYRTIIPRNVRLAEAPSFGAPAMHYDKSSVGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+++++   ++
Sbjct: 242 YLALAGEILRRQEQERQ 258


>gi|330840108|ref|YP_004414688.1| Cobyrinic acid ac-diamide synthase [Selenomonas sputigena ATCC
           35185]
 gi|329747872|gb|AEC01229.1| Cobyrinic acid ac-diamide synthase [Selenomonas sputigena ATCC
           35185]
          Length = 253

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 180/253 (71%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT++NLS  LA +G+ VLLID DPQGNA++G GI   D   + Y
Sbjct: 2   AKIIAVANQKGGVGKTTTSVNLSAGLAMLGKRVLLIDSDPQGNATSGFGINKSDLTITIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI+   I + ++ T    + ++P+ ++L G E+ L     R  RL +++   +   + 
Sbjct: 62  QVLIDNLAIEKAVLHTGY-EVDLLPANIELAGAEIELVAAISRENRLKRSVDA-VRDQYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AAD++L+P+QCEF+ALEGL+QL+ T+  V+  +N AL+++G
Sbjct: 120 FILIDCPPSLGLLTLNALTAADTVLMPIQCEFYALEGLAQLMNTMTLVQTNLNPALEVEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS QV  +VR + G KVY TVIPR VR+SEAPSYG+P I YD  C G+ 
Sbjct: 180 VLLTMFDSRTNLSVQVAEEVRTHFGSKVYRTVIPRTVRLSEAPSYGQPVIAYDRNCKGAI 239

Query: 246 AYLKLASELIQQE 258
            Y+ LA E+I+++
Sbjct: 240 VYMDLAKEVIERD 252


>gi|162451416|ref|YP_001613783.1| partition protein, ParA-like protein [Sorangium cellulosum 'So ce
           56']
 gi|161161998|emb|CAN93303.1| Partition protein, ParA homolog [Sorangium cellulosum 'So ce 56']
          Length = 310

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 119/248 (47%), Positives = 172/248 (69%), Gaps = 3/248 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           I  +ANQKGGVGKTTT++NL+ + AA     LL+D DPQGNAS+G+G+     + S YD+
Sbjct: 23  IFAVANQKGGVGKTTTSVNLAASFAAAECRTLLVDCDPQGNASSGVGVRRGSFELSLYDV 82

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI    +   ++ T +P L ++P+T DL+  E+ L    DR  RL  AL  QL   + Y+
Sbjct: 83  LIGRAALKDAIVATEVPLLGVVPATQDLVAAELELVDADDRAVRLRNALRPQLAG-YDYV 141

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            LDCPPS  LLT+NA+ AA  +LVPLQCE++ALEGL+ L+ T++ VR   N  L ++G++
Sbjct: 142 VLDCPPSLGLLTLNALTAAHRVLVPLQCEYYALEGLTHLMATIDRVRSAFNPELTVEGVV 201

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM+D RNSL+ QV  +V+ +   +V++ +IPRNV++SEAPS+GKPA++YD +  G+Q Y
Sbjct: 202 LTMYDGRNSLTHQVADEVKAHF--RVFDAIIPRNVKLSEAPSHGKPALLYDAQSKGAQGY 259

Query: 248 LKLASELI 255
           L LA E++
Sbjct: 260 LSLAREIL 267


>gi|145301181|ref|YP_001144022.1| chromosome partitioning protein ParA [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853953|gb|ABO92274.1| chromosome partitioning protein ParA [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 267

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 181/256 (70%), Gaps = 2/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT +NL+ +LAA    VL+IDLDPQGNA+ G G++ Y+ + ++Y+
Sbjct: 3   KVIAIANQKGGVGKTTTCVNLAASLAATRRKVLVIDLDPQGNATMGSGVDKYEVERTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLIE+  I +++I        +I +  D+   E+ L     R  RL  A++  +   + Y
Sbjct: 63  LLIEDAPIAEVIIPETSGGYHLIAANADVTAAEIRLMEFFAREIRLRNAIA-SVRDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAMAAADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+G+
Sbjct: 122 IFIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALVDTISKLAAVVNPELKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+  V   ++++ G KVY T+IPRNVR++EAPS+G PA+ YD    G++A
Sbjct: 182 LRTMFDHRNRLANDVSDQLKQHFGDKVYRTIIPRNVRLAEAPSFGAPAMHYDKSSVGAKA 241

Query: 247 YLKLASELI-QQERHR 261
           YL LA E++ +QE+ R
Sbjct: 242 YLALAGEMLRRQEQER 257


>gi|119776785|ref|YP_929525.1| ParA family protein [Shewanella amazonensis SB2B]
 gi|119769285|gb|ABM01856.1| chromosome segregation ATPase [Shewanella amazonensis SB2B]
          Length = 262

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 125/262 (47%), Positives = 184/262 (70%), Gaps = 4/262 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I +ANQKGGVGKTTT INL+ +LAA    VLLIDLDPQGNA+ G G++ Y+ + ++Y
Sbjct: 2   GKVIAVANQKGGVGKTTTCINLAASLAATRRKVLLIDLDPQGNATMGSGVDKYEVENTAY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LL+EEK    ++++       +I +  D+   E+ L     R  RL  AL+  +   + 
Sbjct: 62  ELLVEEKPFADVVVKDTQGKYDLIAANGDVTAAEIKLMEFFAREVRLRNALA-PIRDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N+LT+NAM+AADS+LVP+QCE+FALEGL+ L++T+ ++   VN  L I+G
Sbjct: 121 FIFIDCPPSLNMLTVNAMSAADSVLVPMQCEYFALEGLTALIDTIGKLASMVNPGLGIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRN+R++EAPS+G PA+ YD   AG++
Sbjct: 181 ILRTMYDPRNRLANDVSDQLKQHFGEKVYRTVIPRNIRLAEAPSFGAPAMYYDKSSAGAK 240

Query: 246 AYLKLASELI---QQERHRKEA 264
           AYL LA E+I   +Q + +K+A
Sbjct: 241 AYLALAGEIIRRGEQTQAKKQA 262


>gi|149370640|ref|ZP_01890329.1| regulator protein; cell division inhibitor [unidentified
           eubacterium SCB49]
 gi|149356191|gb|EDM44748.1| regulator protein; cell division inhibitor [unidentified
           eubacterium SCB49]
          Length = 254

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 176/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NAS+GLGI++      +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVETVMQGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL    +    +I T  PNL IIP+ +DL+ IE+ L  +++R + L KA+   L S + Y
Sbjct: 63  LLEHSVSAEDAVIPTNSPNLDIIPAHIDLVAIEIELVDKEEREYMLKKAIH-HLKSTYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL TV+ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTVKSVQKIHNPDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVNKHFDAMVFKTIIQRNVRLSEAPSYGESIISYDATSKGANN 241

Query: 247 YLKLASELIQQ 257
           YL LA ELI++
Sbjct: 242 YLSLAEELIKK 252


>gi|167038664|ref|YP_001666242.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320117056|ref|YP_004187215.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166857498|gb|ABY95906.1| Cobyrinic acid a,c-diamide synthase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319930147|gb|ADV80832.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 255

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT INL  +LA  G+ VL ID+DPQ N ++G GI     K+++Y 
Sbjct: 3   KVIAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE+++I   +I      +SI+PS++ L G E+ L     R ++L  A++ Q+  +F Y
Sbjct: 63  VLIEDEDIRNAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKNAVN-QIKDEFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N  L+I+G+
Sbjct: 122 ILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPELEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPS+GKP  IYD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKDKVYGTIIPRNIRLGEAPSFGKPISIYDPSSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y +LA E+I++
Sbjct: 242 YDELAVEVIER 252


>gi|291288865|ref|YP_003505681.1| Cobyrinic acid ac-diamide synthase [Denitrovibrio acetiphilus DSM
           12809]
 gi|290886025|gb|ADD69725.1| Cobyrinic acid ac-diamide synthase [Denitrovibrio acetiphilus DSM
           12809]
          Length = 254

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTTAINLS+AL      VL++D+DPQGNA++GLG+ L D   S YD
Sbjct: 3   KIIAIANQKGGVGKTTTAINLSSALGFADAKVLVVDMDPQGNATSGLGVVLSDESASIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI        +  T I NL IIP  ++L   E+ L  E  R  +L KAL+  +  ++++
Sbjct: 63  VLIGRAETKSTIRPTKIENLDIIPGNINLSAAEVELVTEMSRETKLKKALAC-VRDEYNF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ AADS+L+PLQCE++A+EGL QLL T+  +R ++N  L+++GI
Sbjct: 122 IMIDCPPSLGLLTINSLTAADSVLIPLQCEYYAMEGLGQLLNTIRLIRESLNEDLELEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD RN+LS++V   V + L   ++NT+IPRNVR+SEAPS+G+  I YD+K  G+ +
Sbjct: 182 LLTMFDPRNNLSKEVQKQVEEYLHDSIFNTIIPRNVRLSEAPSFGQSIIEYDIKSKGAAS 241

Query: 247 YLKLASELIQQ 257
           Y++LA E++ +
Sbjct: 242 YIELAKEMLAR 252


>gi|300871871|ref|YP_003786744.1| cobyrinic acid ac-diamide synthase [Brachyspira pilosicoli 95/1000]
 gi|300689572|gb|ADK32243.1| cobyrinic acid ac-diamide synthase [Brachyspira pilosicoli 95/1000]
          Length = 254

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 179/254 (70%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II+I NQKGGVGKTTTA+NLS+ +A++G   LLID+DPQ NA  G+G+     +Y  Y
Sbjct: 2   SKIISIVNQKGGVGKTTTAVNLSSIVASMGYKTLLIDIDPQANACLGIGVTRDKMEYGIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E +I Q++I T   NL +IPS  DL+G ++ L  E  R ++L KAL  ++ +++ 
Sbjct: 62  DILIGEADIEQVIINTYQENLYLIPSDSDLVGAQIELVSEIGREYKLKKALE-KIRNNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPP+  +LT+NA+ A DS+L+P+QCEF+AL+G+ +L  T+  V+  +N  L I+G
Sbjct: 121 YIFIDCPPTLGILTLNALTACDSVLIPIQCEFYALDGVGELNNTISLVKENLNPNLHIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D R +LS  VV +V      K Y T+IPRNVR+SEAPSYGK    YD +C G++
Sbjct: 181 VLLTMYDGRTNLSNDVVREVVNYFKDKTYKTMIPRNVRLSEAPSYGKAITDYDKECIGAR 240

Query: 246 AYLKLASELIQQER 259
           +Y + A E I++ +
Sbjct: 241 SYKEFAKEFIERSK 254


>gi|331002969|ref|ZP_08326481.1| hypothetical protein HMPREF0491_01343 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330413013|gb|EGG92388.1| hypothetical protein HMPREF0491_01343 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 256

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 186/253 (73%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II+ ANQKGGVGKTTTA+NLS ALA  G++VL ID DPQGN S+GLGI+  +   + Y
Sbjct: 2   TKIISFANQKGGVGKTTTAVNLSAALAEAGQSVLAIDFDPQGNLSSGLGIDKLNTTKTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +++I E+NIN +++ + + NL IIPS +DL G E+ L   +DR   L + +S ++  ++ 
Sbjct: 62  EVIIGEENINDVILNSEVENLDIIPSNVDLSGAEIELLELEDRERTLRRKIS-EIYKNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NA  A+DS+++P+QCE++ALEGL+Q+L TV  +R  +N  L+I+G
Sbjct: 121 YILIDCPPSLSLLTINAFMASDSVVIPIQCEYYALEGLNQMLRTVNLIRERLNPTLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGK-VYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           I+ TM+D+RN+LS QV+  V+  +  + ++ T+IPRNV+++EAPS+G P   YD    G+
Sbjct: 181 IVFTMYDARNNLSGQVIEGVKGVISNENIFETIIPRNVKLAEAPSFGMPITEYDTTSTGA 240

Query: 245 QAYLKLASELIQQ 257
           QAY  LASE++ +
Sbjct: 241 QAYRMLASEVLSR 253


>gi|163756812|ref|ZP_02163921.1| SpoOJ regulator protein [Kordia algicida OT-1]
 gi|161323201|gb|EDP94541.1| SpoOJ regulator protein [Kordia algicida OT-1]
          Length = 256

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESIEKGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL    N   ++++T+ PNLSIIP+ +DL+ IE+ L  +  R + L KAL   +   + Y
Sbjct: 63  LLEHTVNAADVVMETSSPNLSIIPAHIDLVAIEIELVDKDQREYMLRKALK-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AAD++++P+QCE+FALEGL +LL T++ V++  N ALDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADAVMIPIQCEYFALEGLGKLLNTIKSVQKIHNPALDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V++T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFNDMVFSTIIQRNVRLSEAPSYGESIINYDASSKGATN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAHEVIKK 252


>gi|259047767|ref|ZP_05738168.1| sporulation initiation inhibitor protein Soj [Granulicatella
           adiacens ATCC 49175]
 gi|259035958|gb|EEW37213.1| sporulation initiation inhibitor protein Soj [Granulicatella
           adiacens ATCC 49175]
          Length = 253

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 120/252 (47%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I++ANQKGGVGKTT+ ++L+ ALA  G+ VL+ID DPQGNA++GLG++  + +   YD
Sbjct: 3   RVISVANQKGGVGKTTSTVSLAAALAVNGKKVLIIDSDPQGNATSGLGVQKGELEQDVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ +  +  +++ T+  NL I PST+ L G E+ L  +  R  RL +A+  ++  D+ Y
Sbjct: 63  VLVNQVPMADVIVPTSRENLMIAPSTIQLAGAEIELTSQPRREQRLKEAVK-KIKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS   LTMNA  A+D++L+P+QCE++ALEGLSQL+ T+  VR+  N  L I+G+
Sbjct: 122 IFIDCPPSLGHLTMNAFTASDTVLIPVQCEYYALEGLSQLMNTITMVRKHFNPHLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D+R +L  +V  DV K    KVY T+IPRNVR+SEAPSYG+  + YD +  G++ 
Sbjct: 182 LLTMYDARTNLGNEVKEDVIKYFREKVYKTIIPRNVRLSEAPSYGQAIVDYDPRSRGAEV 241

Query: 247 YLKLASELIQQE 258
           Y++LA E++  E
Sbjct: 242 YMELAKEVLAHE 253


>gi|91777101|ref|YP_546857.1| chromosome segregation ATPase [Methylobacillus flagellatus KT]
 gi|91711088|gb|ABE51016.1| chromosome segregation ATPase [Methylobacillus flagellatus KT]
          Length = 262

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ I NQKGGVGKTTT +NL+ +LAA    VL+IDLDPQGNA+TG GI+    +++ Y 
Sbjct: 2   RILAITNQKGGVGKTTTCVNLAASLAATKRKVLVIDLDPQGNATTGCGIDKSKMQHTIYH 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI EK++  ++ ++      ++P+  +L G E+ L  E  R  RL  AL+ +L   + Y
Sbjct: 62  VLIGEKSLRDVMQRSERGRFDVVPANRELAGAEVELVNEFARETRLKSALA-ELGDAYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ NL T+NA+ AA ++++P+QCE++ALEGLS L+ T+++VR  +N  L+I+G+
Sbjct: 121 VLIDCPPALNLTTVNALTAAHAVMIPMQCEYYALEGLSDLVNTIKKVRAHLNPHLEIEGL 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + T+FD+RN+L+QQV +++ ++ G KVY TVIPRN+R++EAPSYG P +++D    G++A
Sbjct: 181 LRTLFDNRNTLAQQVSNELAQHFGDKVYRTVIPRNIRLAEAPSYGVPVLLHDKTSKGAKA 240

Query: 247 YLKLASELIQQE 258
           YL LA E+I + 
Sbjct: 241 YLALAGEIINRH 252


>gi|313203926|ref|YP_004042583.1| chromosome segregation ATPase [Paludibacter propionicigenes WB4]
 gi|312443242|gb|ADQ79598.1| chromosome segregation ATPase [Paludibacter propionicigenes WB4]
          Length = 257

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 189/255 (74%), Gaps = 5/255 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII++ANQKGGVGKTTTAINL+ +LA++G+ VLLID DPQ NAS+GLG+++   +++ Y+
Sbjct: 3   RIISLANQKGGVGKTTTAINLAASLASLGKKVLLIDADPQANASSGLGVDIRTLEFTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSDF 124
            LI+     Q + QT + NL I+PS +DL+G  IEM+    ++R+    + +   L S +
Sbjct: 63  CLIDNVPPAQAIHQTDVENLYILPSHIDLVGAEIEMLNMDNRERVM---ENILTPLKSSY 119

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+ +DC PS  L+T+NA+ A+DS+++P+QCE+FALEG+S+LL T++ ++  +N+AL+I+
Sbjct: 120 DYLLIDCSPSLGLITVNALTASDSVIIPVQCEYFALEGISKLLNTIKIIKSKLNTALEIE 179

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G +LTM+D+R  L+ QV ++VRK+  G V+ +VI RNVR+SEAPS+GKP ++YD +  GS
Sbjct: 180 GFLLTMYDNRLRLANQVYAEVRKHFEGMVFESVITRNVRLSEAPSHGKPVLLYDAESKGS 239

Query: 245 QAYLKLASELIQQER 259
             Y+ LA ELI + +
Sbjct: 240 TNYMDLAKELIAKNK 254


>gi|303326118|ref|ZP_07356561.1| sporulation initiation inhibitor protein SOJ [Desulfovibrio sp.
           3_1_syn3]
 gi|302864034|gb|EFL86965.1| sporulation initiation inhibitor protein SOJ [Desulfovibrio sp.
           3_1_syn3]
          Length = 262

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII+IANQKGGVGKTTTAINLS ALA + + VLL+D DPQ N+++GLG+   +     Y
Sbjct: 2   ARIISIANQKGGVGKTTTAINLSAALAVMEKKVLLVDCDPQANSTSGLGLSQEELTGDLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
                  N++Q + ++  P L I+P++ +L+ +E+ L  +  R F LD+ L  ++  D+ 
Sbjct: 62  STFYSPDNVHQSIAKSRTPFLDILPASTNLVAVELELVDKMAREFYLDECLK-RVNDDYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  LLT+NA+ AA  +L+PLQCEFFALEG+ +LL+T E+V++ +N  L + G
Sbjct: 121 YIVLDCPPSLGLLTLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKKRLNPELALLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+RN L+++V ++VR+     ++ TVIPRNVR+SEAPS+GK  I YD+K  G++
Sbjct: 181 VVLTMYDTRNRLTREVKNEVRRCFPDHLFETVIPRNVRLSEAPSHGKSIIHYDIKSKGAE 240

Query: 246 AYLKLASELIQQERHRK 262
           AYL LA E++ +   +K
Sbjct: 241 AYLGLAKEVVLRRPSKK 257


>gi|260685214|ref|YP_003216499.1| sporulation initiation inhibitor [Clostridium difficile CD196]
 gi|260688873|ref|YP_003220007.1| sporulation initiation inhibitor [Clostridium difficile R20291]
 gi|260211377|emb|CBA67028.1| sporulation initiation inhibitor [Clostridium difficile CD196]
 gi|260214890|emb|CBE07693.1| sporulation initiation inhibitor [Clostridium difficile R20291]
          Length = 284

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 180/245 (73%), Gaps = 1/245 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I + NQKGGVGKTTT +NLS +L  +G+ +L++DLDPQGN ++G GI   + + + Y+
Sbjct: 30  KVIAVFNQKGGVGKTTTNVNLSASLGTLGKKILVLDLDPQGNTTSGYGINKNEVENTIYE 89

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++++  +I + +I T   N+ ++PS  +L G E+ L  + +R + L  ++   +  ++ Y
Sbjct: 90  IMLDGLHIKEAIISTEFENVDVVPSATELSGAEIELTSKTNREYILKNSIKA-VIDEYDY 148

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IFLDCPPS  +LT+N + A DS+L+P+QCE++ALEG+SQL+ET++ V+  +N+ ++IQG+
Sbjct: 149 IFLDCPPSLGMLTINCLTAVDSVLIPIQCEYYALEGVSQLMETIKLVKSRLNADIEIQGV 208

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +L+MFD R +LS QVV +V+K   G VY T+IPRNVR++EAPS+GKP I YD +C GS A
Sbjct: 209 VLSMFDGRANLSIQVVEEVKKYFKGSVYTTLIPRNVRLAEAPSHGKPVIYYDKRCRGSVA 268

Query: 247 YLKLA 251
           YL+LA
Sbjct: 269 YLELA 273


>gi|332291103|ref|YP_004429712.1| chromosome partitioning protein ParA [Krokinobacter diaphorus
           4H-3-7-5]
 gi|332169189|gb|AEE18444.1| chromosome partitioning protein ParA [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 255

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETVEVGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL    N  + +I+T+ PNL IIP+ +DL+ IE+ L  ++ R + + KA+   L   + Y
Sbjct: 63  LLEHTNNAEEAIIKTSSPNLDIIPAHIDLVAIEIELVDKEAREYMMKKAIG-HLRDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNPDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V+K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVQKHFSEMVFETIIQRNVRLSEAPSYGESIINYDAASKGATN 241

Query: 247 YLKLASELIQQ 257
           YL LA ELI +
Sbjct: 242 YLSLAQELITK 252


>gi|254977333|ref|ZP_05273805.1| sporulation initiation inhibitor [Clostridium difficile QCD-66c26]
 gi|255094664|ref|ZP_05324142.1| sporulation initiation inhibitor [Clostridium difficile CIP 107932]
 gi|255308710|ref|ZP_05352881.1| sporulation initiation inhibitor [Clostridium difficile ATCC 43255]
 gi|255316417|ref|ZP_05358000.1| sporulation initiation inhibitor [Clostridium difficile QCD-76w55]
 gi|255519077|ref|ZP_05386753.1| sporulation initiation inhibitor [Clostridium difficile QCD-97b34]
 gi|255652260|ref|ZP_05399162.1| sporulation initiation inhibitor [Clostridium difficile QCD-37x79]
 gi|255657629|ref|ZP_05403038.1| sporulation initiation inhibitor [Clostridium difficile QCD-23m63]
 gi|296452690|ref|ZP_06894381.1| sporulation initiation inhibitor protein Soj [Clostridium difficile
           NAP08]
 gi|296880058|ref|ZP_06904027.1| sporulation initiation inhibitor protein Soj [Clostridium difficile
           NAP07]
 gi|306521975|ref|ZP_07408322.1| sporulation initiation inhibitor [Clostridium difficile QCD-32g58]
 gi|296258472|gb|EFH05376.1| sporulation initiation inhibitor protein Soj [Clostridium difficile
           NAP08]
 gi|296428925|gb|EFH14803.1| sporulation initiation inhibitor protein Soj [Clostridium difficile
           NAP07]
          Length = 257

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 180/245 (73%), Gaps = 1/245 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I + NQKGGVGKTTT +NLS +L  +G+ +L++DLDPQGN ++G GI   + + + Y+
Sbjct: 3   KVIAVFNQKGGVGKTTTNVNLSASLGTLGKKILVLDLDPQGNTTSGYGINKNEVENTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++++  +I + +I T   N+ ++PS  +L G E+ L  + +R + L  ++   +  ++ Y
Sbjct: 63  IMLDGLHIKEAIISTEFENVDVVPSATELSGAEIELTSKTNREYILKNSIKA-VIDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IFLDCPPS  +LT+N + A DS+L+P+QCE++ALEG+SQL+ET++ V+  +N+ ++IQG+
Sbjct: 122 IFLDCPPSLGMLTINCLTAVDSVLIPIQCEYYALEGVSQLMETIKLVKSRLNADIEIQGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +L+MFD R +LS QVV +V+K   G VY T+IPRNVR++EAPS+GKP I YD +C GS A
Sbjct: 182 VLSMFDGRANLSIQVVEEVKKYFKGSVYTTLIPRNVRLAEAPSHGKPVIYYDKRCRGSVA 241

Query: 247 YLKLA 251
           YL+LA
Sbjct: 242 YLELA 246


>gi|261410101|ref|YP_003246342.1| Cobyrinic acid ac-diamide synthase [Paenibacillus sp. Y412MC10]
 gi|329925018|ref|ZP_08279962.1| sporulation initiation inhibitor protein Soj [Paenibacillus sp.
           HGF5]
 gi|261286564|gb|ACX68535.1| Cobyrinic acid ac-diamide synthase [Paenibacillus sp. Y412MC10]
 gi|328940137|gb|EGG36469.1| sporulation initiation inhibitor protein Soj [Paenibacillus sp.
           HGF5]
          Length = 253

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+II IANQKGGVGKTTT++NL   LA++G+ VLL+D+DPQGN ++G+GI   D     Y
Sbjct: 2   SKIIAIANQKGGVGKTTTSVNLGAGLASLGKRVLLVDIDPQGNTTSGVGINKADVANCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I E +    +  T I  L IIP+T+ L G E+ L     R  RL K+L + +   + 
Sbjct: 62  DIIINEVHPKDAICGTNIEGLDIIPATIQLAGAEIELVPTISREVRLKKSLQL-VKPQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ AADS+++P+QCE++ALEGLSQLL TV  V++ +N++L I+G
Sbjct: 121 YILIDCPPSLGILTINSLTAADSVIIPIQCEYYALEGLSQLLNTVRLVQKHLNTSLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  QV+ +V+K    KVY T+IPRN+R+SEAPS+G+  I YD +  G++
Sbjct: 181 VLLTMLDARTNLGIQVIEEVKKYFQEKVYKTIIPRNIRLSEAPSHGQSIITYDPRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            YL+LA E+I  E
Sbjct: 241 VYLELAKEVISYE 253


>gi|126701300|ref|YP_001090197.1| sporulation initiation inhibitor [Clostridium difficile 630]
 gi|255102890|ref|ZP_05331867.1| sporulation initiation inhibitor [Clostridium difficile QCD-63q42]
 gi|115252737|emb|CAJ70581.1| Transcriptional regulator, sporulation initiation inhibitor,
           chromosome partitioning protein [Clostridium difficile]
          Length = 257

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 180/245 (73%), Gaps = 1/245 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I + NQKGGVGKTTT +NLS +L  +G+ +L++DLDPQGN ++G GI   + + + Y+
Sbjct: 3   KVIAVFNQKGGVGKTTTNVNLSASLGTLGKKILVLDLDPQGNTTSGYGINKNEVENTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++++  +I + +I T   N+ ++PS  +L G E+ L  + +R + L  ++   +  ++ Y
Sbjct: 63  IMLDGLHIKEAIISTEFENIDVVPSATELSGAEIELTSKTNREYILKNSIKA-VIDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IFLDCPPS  +LT+N + A DS+L+P+QCE++ALEG+SQL+ET++ V+  +N+ ++IQG+
Sbjct: 122 IFLDCPPSLGMLTINCLTAVDSVLIPIQCEYYALEGVSQLMETIKLVKSRLNADIEIQGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +L+MFD R +LS QVV +V+K   G VY T+IPRNVR++EAPS+GKP I YD +C GS A
Sbjct: 182 VLSMFDGRANLSIQVVEEVKKYFKGSVYTTLIPRNVRLAEAPSHGKPVIYYDKRCRGSVA 241

Query: 247 YLKLA 251
           YL+LA
Sbjct: 242 YLELA 246


>gi|256830803|ref|YP_003159531.1| Cobyrinic acid ac-diamide synthase [Desulfomicrobium baculatum DSM
           4028]
 gi|256579979|gb|ACU91115.1| Cobyrinic acid ac-diamide synthase [Desulfomicrobium baculatum DSM
           4028]
          Length = 262

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++ I +ANQKGGVGKTTT +NL+ +LAA+ + VL+ID DPQ NAS+GLG+++ + K S Y
Sbjct: 2   AQTIVLANQKGGVGKTTTTVNLAASLAAMEQRVLVIDCDPQANASSGLGVDVSNVKKSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
             L         ++ + +  L I+PST DL+G E+ LG EKDR F L +++   L+ ++ 
Sbjct: 62  QALFSPAEARTAIVDSDMEFLKILPSTPDLVGAEIELGEEKDREFIL-RSIVKLLSPEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  L+T+NA+ AA  +LVPLQCE++ALEG++QL++T   V+  +N  LDI G
Sbjct: 121 YILIDCPPSLGLITINALCAAKWLLVPLQCEYYALEGIAQLMKTYTLVKERLNPELDILG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD RN LS  V  +VR +    V+ T IPRNVR+SEAPS+G PAI+YD++  G+Q
Sbjct: 181 ILLTMFDKRNKLSFMVEREVRDHFKELVFTTSIPRNVRLSEAPSHGLPAILYDIRSMGTQ 240

Query: 246 AYLKLASELIQQERHRKEA 264
           +Y+ LA ELI ++  + +A
Sbjct: 241 SYIALAQELIDKKMGQPQA 259


>gi|315650205|ref|ZP_07903280.1| sporulation initiation inhibitor protein Soj [Eubacterium saburreum
           DSM 3986]
 gi|315487562|gb|EFU77870.1| sporulation initiation inhibitor protein Soj [Eubacterium saburreum
           DSM 3986]
          Length = 260

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 186/258 (72%), Gaps = 2/258 (0%)

Query: 1   MEEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           M    ++II+ ANQKGGVGKTTTA+NLS ALA  G++VL ID DPQGN S+GLGI+  + 
Sbjct: 1   MNNIMTKIISFANQKGGVGKTTTAVNLSAALAEAGQSVLAIDFDPQGNLSSGLGIDKLNT 60

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
             + Y+++I ++NIN  ++ T + NL IIPS +DL G E+ L   +DR   L + +S +L
Sbjct: 61  AKTIYEVIIGDENINDAILNTEVENLDIIPSNVDLSGAEIELLELEDRERTLRRKIS-EL 119

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
             ++ YI +DCPPS +LLT+NA  A+DS+++P+QCE++ALEGL+Q+L TV  +R  +N  
Sbjct: 120 YKEYDYIIIDCPPSLSLLTINAFMASDSVVIPIQCEYYALEGLNQMLRTVNLIRERLNPT 179

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGK-VYNTVIPRNVRISEAPSYGKPAIIYDL 239
           L+I+GI+ TM+D+RN+LS QV+  V+  +  + ++ T+IPRNV+++EAPS+G P   YD 
Sbjct: 180 LEIEGIVFTMYDARNNLSGQVIEGVKSVISNENIFETIIPRNVKLAEAPSFGMPITEYDT 239

Query: 240 KCAGSQAYLKLASELIQQ 257
              G+QAY  LASE++ +
Sbjct: 240 TSTGAQAYRMLASEVLSK 257


>gi|305666520|ref|YP_003862807.1| SpoOJ regulator protein [Maribacter sp. HTCC2170]
 gi|88708787|gb|EAR01022.1| SpoOJ regulator protein [Maribacter sp. HTCC2170]
          Length = 257

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 124/253 (49%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT +NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTTVNLAASLGVLEKKVLLIDADPQANATSGLGIDVEGVENGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL   K   + +I T  PNL +IPS +DL+ IE+ L  + +R + + KA+ + L + + +
Sbjct: 63  LLEHTKTAKETIIPTDSPNLDLIPSHIDLVAIEIELVDKDEREYMMKKAI-LDLKNHYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNPDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +VRK+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVRKHFADMVFETIIQRNVRLSEAPSYGESIIKYDASSKGASN 241

Query: 247 YLKLASELIQQER 259
           YL +A+EL+++ +
Sbjct: 242 YLNMANELLKKNK 254


>gi|239993737|ref|ZP_04714261.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonas macleodii ATCC 27126]
          Length = 264

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I IANQKGGVGKTTTA+N++ ++AA    VLLIDLDPQGNA+ G G++ YD + +++
Sbjct: 2   AKVIAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDVESTAF 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LLIEEK IN ++++       +I +  D+   E+ L     R  RL  AL   +   + 
Sbjct: 62  ELLIEEKPINDVIVKATSGKYDLIAANGDVTAAEIKLMEMFAREVRLRNALK-PVMDYYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++F+DCPPS N LT+NA+AAADS++VP+QCE++ALEGL+ L++T++++   VN  L I+G
Sbjct: 121 FVFIDCPPSLNQLTVNALAAADSVMVPMQCEYYALEGLTALMDTIQKLASVVNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D RN L+  V   ++++ G +VY TVIPRNVR++EAPS+G PA+ YD    G++
Sbjct: 181 VLRTMYDPRNRLANDVSEQLKRHFGEQVYRTVIPRNVRLAEAPSFGTPAMYYDKSSTGAK 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E++++
Sbjct: 241 AYLALAGEILRR 252


>gi|308051496|ref|YP_003915062.1| chromosome segregation ATPase [Ferrimonas balearica DSM 9799]
 gi|307633686|gb|ADN77988.1| chromosome segregation ATPase [Ferrimonas balearica DSM 9799]
          Length = 264

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I IANQKGGVGKTTT+INL+ ++AA    VLLIDLDPQGNA+ G G++ Y+ + ++Y
Sbjct: 2   AKVIAIANQKGGVGKTTTSINLAASMAATRRKVLLIDLDPQGNATMGSGVDKYEVENTAY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LL++EK   +++++       +I +  D+   E+ L     R  RL  AL   +   + 
Sbjct: 62  ELLVDEKPAEEVIVRDTSGKYDLIAANADVTAAEIKLMEFFAREVRLRNALE-PILDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS N+LT+NAM AADS+++P+QCE++ALEGL+ L++T+ ++ + VN +L I+G
Sbjct: 121 YIFIDCPPSLNMLTVNAMGAADSVVIPMQCEYYALEGLTALMDTIGKLAQVVNPSLTIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++ + G KVY TVIPRNVR++EAPS+G PA+ YD   AG++
Sbjct: 181 ILRTMYDPRNRLANDVSDQLKTHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAK 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E++++
Sbjct: 241 AYLALAGEMLRR 252


>gi|46581759|ref|YP_012567.1| ParA family protein [Desulfovibrio vulgaris str. Hildenborough]
 gi|46451182|gb|AAS97827.1| ParA family protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 276

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 184/259 (71%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTT+++NL+ +LA + + VLL+D DPQ N+++GLG +  D + S Y
Sbjct: 16  ARIIAIANQKGGVGKTTSSVNLAASLAIMEKKVLLVDCDPQANSTSGLGFDQEDIERSLY 75

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
               + + +   ++ T+ P LS++P+T DL+ IE+ L  +  R + L   L   L S + 
Sbjct: 76  TSFFQPEEVVDAILTTSSPFLSLLPATTDLVAIELELVDKMAREYYLADLLK-PLDSRYD 134

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  L+T+NA+ AA  +L+PLQCEFFALEG+ +LL+T E+V+R +N  L + G
Sbjct: 135 YILLDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKRRLNQNLSLLG 194

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN LS+QV ++VRK     ++ TVIPRNVR+SEAPS+GK  I YD+K  G++
Sbjct: 195 VVLTMYDVRNKLSRQVKNEVRKCFPDHLFETVIPRNVRLSEAPSHGKSIIHYDIKSKGAE 254

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E++ ++  R++A
Sbjct: 255 AYLALAKEVVLRKPQRRDA 273


>gi|332995869|gb|AEF05924.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonas sp. SN2]
          Length = 264

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 183/260 (70%), Gaps = 4/260 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I IANQKGGVGKTTTA+N++ ++AA    VLLIDLDPQGNA+ G G++ YD   +++
Sbjct: 2   AKVIAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDVHATAF 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LLIEE+ IN ++++       ++ +  D+   E+ L     R  RL  AL   L   + 
Sbjct: 62  ELLIEEQPINDVIVKNTAGKFDLVAANGDVTAAEIKLMEMFAREVRLRNALKPVLDY-YD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS N LT+NA+AAADS++VP+QCE++ALEGL+ L++T++++   VN  L I+G
Sbjct: 121 FIFIDCPPSLNQLTVNALAAADSVMVPMQCEYYALEGLTALMDTIQKLASVVNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D RN L+  V   ++++ G +VY TVIPRNVR++EAPS+G PA+ YD    G++
Sbjct: 181 VLRTMYDPRNRLANDVSEQLKRHFGEQVYRTVIPRNVRLAEAPSFGTPAMYYDKSSTGAK 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E++   R R ++A
Sbjct: 241 AYLALAGEIL---RRRDKSA 257


>gi|218887137|ref|YP_002436458.1| cobyrinic acid ac-diamide synthase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758091|gb|ACL08990.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 262

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII +ANQKGGVGKTT+++NL+ +LA + + VLL+D DPQ N+++GLGI+  + +++ Y
Sbjct: 2   ARIIAVANQKGGVGKTTSSLNLAASLAIMEKKVLLVDCDPQANSTSGLGIDQEEVRHNLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +  +   + + +  T  P LSI+PST DL+ +E+ L  +  R + L   L   L S F 
Sbjct: 62  SVFFQPDEVVEAIYPTQTPYLSILPSTTDLVALELELVDKMAREYYLADLLK-PLDSRFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  L+T+NA+ AA  +L+PLQCEFFALEG+ +LL+T E+V++ +N  L + G
Sbjct: 121 YIILDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKKRLNPGLSLLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN LS+QV ++VRK     ++ TVIPRNVR+SEAPS+GK  I YD+K  G++
Sbjct: 181 VVLTMYDVRNKLSRQVKNEVRKCFPDHLFETVIPRNVRLSEAPSHGKSIIHYDIKSKGAE 240

Query: 246 AYLKLASELIQQERHRKEA 264
           +YL LA E++ +   R+E 
Sbjct: 241 SYLALAKEVVLRRPQRREG 259


>gi|220936469|ref|YP_002515368.1| chromosome segregation ATPase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997779|gb|ACL74381.1| chromosome segregation ATPase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 264

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/254 (46%), Positives = 182/254 (71%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+TIANQKGGVGKTTT++NL+ +LAA    VL+IDLDPQGNA+ G  ++ +D +++S 
Sbjct: 2   AKILTIANQKGGVGKTTTSVNLAASLAATKRRVLMIDLDPQGNATMGSAVDKHDLEFTSC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+    I + +        SI+P+  DL   E+ L   + R FRL +AL+  + ++F 
Sbjct: 62  DVLMGRTPIREAIQYVEAVGYSILPANADLTEAEVSLMQAERREFRLKEALA-PVVAEFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS N+LT+NA+ AA  +L+P+QCE++ALEGLS L  T+E +R++VN  L ++G
Sbjct: 121 YIIIDCPPSLNMLTVNALVAATGVLIPMQCEYYALEGLSALTRTIESIRQSVNPDLQVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D RN+L+  V + + ++ G +VY T+IPRNVR++EAPSYG P ++YD    G+ 
Sbjct: 181 VLRTMYDPRNNLATDVSAQLEQHFGERVYRTIIPRNVRLAEAPSYGLPILLYDKPSRGAM 240

Query: 246 AYLKLASELIQQER 259
           AYL LA E++++ER
Sbjct: 241 AYLALAGEILRRER 254


>gi|170016608|ref|YP_001727527.1| ParaA family ATPase [Leuconostoc citreum KM20]
 gi|169803465|gb|ACA82083.1| ATPase, ParA family [Leuconostoc citreum KM20]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 183/252 (72%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + II +ANQKGGVGKTTT+INL  ALA  G+ VLL+D+D QGNA++G GI+  +    SY
Sbjct: 2   AHIIALANQKGGVGKTTTSINLGAALAQDGQRVLLVDIDAQGNATSGSGIDKSELALDSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++++   +  +++ T   N  ++P+T+ L G E+ L  +K R +RL KAL + ++ D+ 
Sbjct: 62  DVIVDGAALRDVIVPT--DNYDLLPATIQLSGAEIELATQKQREYRLQKAL-MTVSDDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  LLT+NA  AAD+IL+P+Q EF+ALEGL QLL T+E VR+  N +LDI G
Sbjct: 119 FILIDNPPALGLLTVNAFTAADAILIPVQTEFYALEGLGQLLNTIELVRKQFNESLDIAG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR+  G KVY+TV+PR+VR+SEAPSYG+  I +D K  G+Q
Sbjct: 179 ILLTMYDGRTNLAKQVSEEVRQYFGDKVYHTVVPRSVRLSEAPSYGQAIIDFDPKSIGAQ 238

Query: 246 AYLKLASELIQQ 257
            Y +LA E+++Q
Sbjct: 239 VYTELAQEVLKQ 250


>gi|167041014|ref|YP_001663999.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X514]
 gi|256751465|ref|ZP_05492343.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913775|ref|ZP_07131092.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter sp. X561]
 gi|307725539|ref|YP_003905290.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X513]
 gi|166855254|gb|ABY93663.1| Cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X514]
 gi|256749684|gb|EEU62710.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300890460|gb|EFK85605.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter sp. X561]
 gi|307582600|gb|ADN55999.1| cobyrinic acid a,c-diamide synthase [Thermoanaerobacter sp. X513]
          Length = 255

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/251 (49%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT INL  +LA  G+ VL ID+DPQ N ++G GI     K+++Y 
Sbjct: 3   KVIAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE+++I   +I      +SI+PS++ L G E+ L     R ++L  A++ Q+  +F Y
Sbjct: 63  VLIEDEDIRNAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKNAVN-QIKDEFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N  L+I+G+
Sbjct: 122 ILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPELEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPS+GKP  IYD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKDKVYGTIIPRNIRLGEAPSFGKPISIYDPNSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y +LA E+I++
Sbjct: 242 YDELALEVIER 252


>gi|45659302|ref|YP_003388.1| hypothetical protein LIC13489 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|294828516|ref|NP_714527.2| ParA [Leptospira interrogans serovar Lai str. 56601]
 gi|45602548|gb|AAS72025.1| ParA [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
 gi|293386369|gb|AAN51545.2| ParA [Leptospira interrogans serovar Lai str. 56601]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 184/248 (74%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I++I+NQKGGVGKTTT+INL+  LA+I + VL+ID+DPQGN+ +GLG+E++    +SY+
Sbjct: 3   KIVSISNQKGGVGKTTTSINLAANLASIEKKVLIIDMDPQGNSGSGLGLEIHKTNKTSYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E ++N+ + +T + NL IIPS ++L G E  L  E  R +RL  A+S  L +++ Y
Sbjct: 63  LLLGEASVNECIQRTNVSNLHIIPSNINLSGAEADLLAEDQREYRLKNAIS-DLRTEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+NA+ AADS+++ LQ E+FALEGL+QL++ +  V+  +N +L+++G+
Sbjct: 122 ILIDCPPSLGILTINALCAADSVMITLQTEYFALEGLTQLMKIISLVQNQLNPSLELEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +L+ QV  DV+     KVY T+IPRNV++SEAPS+G+  + YD +  G+Q+
Sbjct: 182 LLTMFDKRTNLANQVAEDVKSYFKDKVYTTIIPRNVKLSEAPSFGQTILSYDPEGVGAQS 241

Query: 247 YLKLASEL 254
           Y  LA E+
Sbjct: 242 YRSLALEV 249


>gi|71909714|ref|YP_287301.1| chromosome segregation ATPase [Dechloromonas aromatica RCB]
 gi|71849335|gb|AAZ48831.1| chromosome segregation ATPase [Dechloromonas aromatica RCB]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 186/251 (74%), Gaps = 2/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +++ I NQKGGVGKTTTA+NL+ +LAA G+ VLLID+DPQGNA+TG GI   +   + Y 
Sbjct: 2   KVLAITNQKGGVGKTTTAVNLAASLAAEGKRVLLIDMDPQGNATTGSGITKKEALPTVYQ 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI    +  + I+T      I+P+  +L G E+ +   + R +RL KAL+ Q  +++ +
Sbjct: 62  LLIGAATLIDVCIKTDF-YFDILPANRELAGAEVEMIELEQREYRLKKALA-QNHAEYDF 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ N+LT+NA+ AADS+L+P+QCE++ALEGLS L+ET+ +VR+ +NS L+I+G+
Sbjct: 120 VLIDCPPALNMLTVNALVAADSVLIPMQCEYYALEGLSDLVETLRKVRQHLNSRLEIEGL 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM++S+++L+QQV S++  + G KVY T++PRNVR++EAPSYGKP I +D    G+QA
Sbjct: 180 LRTMYNSQSTLTQQVSSELESHFGEKVYKTIVPRNVRLAEAPSYGKPVIAFDKNSKGAQA 239

Query: 247 YLKLASELIQQ 257
           Y  LA E++++
Sbjct: 240 YSALAQEILER 250


>gi|331089223|ref|ZP_08338125.1| hypothetical protein HMPREF1025_01708 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330405775|gb|EGG85304.1| hypothetical protein HMPREF1025_01708 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 255

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 184/251 (73%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT+INLS ALA+ G+ VL +D+DPQGN ++GLG++  + + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTSINLSAALASKGKKVLALDMDPQGNMTSGLGVDKDEAEKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I    I + + + A+ NL ++PS ++L   E+ L G +++ + L   +  ++  ++ +
Sbjct: 63  LIIGNAGIEECICKDALENLDVLPSNINLSAAEIELIGVENKEYILKTEVK-KVKDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ ++LT+NAM  ADSI+VP+QCE++ALEGLSQL+ T+E V+  +N  L+I+G+
Sbjct: 122 VVIDCPPALSMLTINAMTTADSIIVPIQCEYYALEGLSQLIHTIELVQERLNPNLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P  +YD K  G+ +
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNIRLAEAPSYGMPINLYDPKSTGATS 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMLLAEEVIHK 252


>gi|254281613|ref|ZP_04956581.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR51-B]
 gi|219677816|gb|EED34165.1| cobyrinic Acid a,c-diamide synthase [gamma proteobacterium NOR51-B]
          Length = 261

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 183/253 (72%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ +ANQKGGVGKTTT++NL+ +LAA+G ++LL+DLDPQGNA+   GI+ +D + SSYD
Sbjct: 2   KILAVANQKGGVGKTTTSVNLAASLAAMGRDILLVDLDPQGNATMSAGIDKHDIERSSYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++   +N++++      + ++P+  DL   E+ L   + +  RL +AL+   +  +  
Sbjct: 62  LLVDRVPLNKVVVHADTSGIDVVPANSDLTAAEVQLITVEGKERRLREALAT-CSKPYDI 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS N+LT+NA+ AADS+L+ +QCE+FALEGLS LL+TV +V  +VN  L ++G+
Sbjct: 121 VIIDCPPSLNMLTLNALVAADSVLITMQCEYFALEGLSALLDTVHQVSESVNPRLRVEGL 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RNSL+ +V + + ++ G  VY TVIPRNVR++EAPS+G PA+ YD    GS+A
Sbjct: 181 VRTMYDPRNSLTNEVSAQLHEHFGDLVYRTVIPRNVRLAEAPSHGLPAMHYDRYSRGSRA 240

Query: 247 YLKLASELIQQER 259
           Y+ LA E  ++++
Sbjct: 241 YMALAGEFTKRQQ 253


>gi|120601088|ref|YP_965488.1| cobyrinic acid a,c-diamide synthase [Desulfovibrio vulgaris DP4]
 gi|120561317|gb|ABM27061.1| chromosome segregation ATPase [Desulfovibrio vulgaris DP4]
 gi|311232318|gb|ADP85172.1| chromosome segregation ATPase [Desulfovibrio vulgaris RCH1]
          Length = 262

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 184/259 (71%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTT+++NL+ +LA + + VLL+D DPQ N+++GLG +  D + S Y
Sbjct: 2   ARIIAIANQKGGVGKTTSSVNLAASLAIMEKKVLLVDCDPQANSTSGLGFDQEDIERSLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
               + + +   ++ T+ P LS++P+T DL+ IE+ L  +  R + L   L   L S + 
Sbjct: 62  TSFFQPEEVVDAILTTSSPFLSLLPATTDLVAIELELVDKMAREYYLADLLK-PLDSRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  L+T+NA+ AA  +L+PLQCEFFALEG+ +LL+T E+V+R +N  L + G
Sbjct: 121 YILLDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTYEQVKRRLNQNLSLLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN LS+QV ++VRK     ++ TVIPRNVR+SEAPS+GK  I YD+K  G++
Sbjct: 181 VVLTMYDVRNKLSRQVKNEVRKCFPDHLFETVIPRNVRLSEAPSHGKSIIHYDIKSKGAE 240

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E++ ++  R++A
Sbjct: 241 AYLALAKEVVLRKPQRRDA 259


>gi|153815413|ref|ZP_01968081.1| hypothetical protein RUMTOR_01648 [Ruminococcus torques ATCC 27756]
 gi|317500875|ref|ZP_07959087.1| sporulation initiation inhibitor protein Soj [Lachnospiraceae
           bacterium 8_1_57FAA]
 gi|145847272|gb|EDK24190.1| hypothetical protein RUMTOR_01648 [Ruminococcus torques ATCC 27756]
 gi|316897755|gb|EFV19814.1| sporulation initiation inhibitor protein Soj [Lachnospiraceae
           bacterium 8_1_57FAA]
          Length = 255

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 184/251 (73%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTT+INLS ALA+ G+ VL +D+DPQGN ++GLG++  + + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTSINLSAALASKGKKVLALDMDPQGNMTSGLGVDKDEAEKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I    I + + + A+ NL ++PS ++L   E+ L G +++ + L   +  ++  ++ +
Sbjct: 63  LIIGNAGIEECICKDALENLDVLPSNINLSAAEIELIGVENKEYILKTEVE-KVKDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPP+ ++LT+NAM  ADSI+VP+QCE++ALEGLSQL+ T+E V+  +N  L+I+G+
Sbjct: 122 VVIDCPPALSMLTINAMTTADSIIVPIQCEYYALEGLSQLIHTIELVQERLNPNLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRN+R++EAPSYG P  +YD K  G+ +
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNIRLAEAPSYGMPINLYDPKSTGATS 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMLLAEEVIHK 252


>gi|29377740|ref|NP_816894.1| ParaA family ATPase [Enterococcus faecalis V583]
 gi|227518145|ref|ZP_03948194.1| chromosome partitioning ATPase [Enterococcus faecalis TX0104]
 gi|227555649|ref|ZP_03985696.1| chromosome partitioning ATPase [Enterococcus faecalis HH22]
 gi|229547165|ref|ZP_04435890.1| chromosome partitioning ATPase [Enterococcus faecalis TX1322]
 gi|229550735|ref|ZP_04439460.1| chromosome partitioning ATPase [Enterococcus faecalis ATCC 29200]
 gi|255971516|ref|ZP_05422102.1| ATPase [Enterococcus faecalis T1]
 gi|255974466|ref|ZP_05425052.1| ATPase [Enterococcus faecalis T2]
 gi|256618561|ref|ZP_05475407.1| ATPase [Enterococcus faecalis ATCC 4200]
 gi|256761821|ref|ZP_05502401.1| ATPase [Enterococcus faecalis T3]
 gi|256854948|ref|ZP_05560309.1| ParaA family ATPase [Enterococcus faecalis T8]
 gi|256957049|ref|ZP_05561220.1| ATPase [Enterococcus faecalis DS5]
 gi|256960913|ref|ZP_05565084.1| ATPase [Enterococcus faecalis Merz96]
 gi|256963949|ref|ZP_05568120.1| ATPase [Enterococcus faecalis HIP11704]
 gi|257078726|ref|ZP_05573087.1| ParaA family ATPase [Enterococcus faecalis JH1]
 gi|257081314|ref|ZP_05575675.1| ParaA family ATPase [Enterococcus faecalis E1Sol]
 gi|257083972|ref|ZP_05578333.1| ParaA family ATPase [Enterococcus faecalis Fly1]
 gi|257087802|ref|ZP_05582163.1| ATPase [Enterococcus faecalis D6]
 gi|257088447|ref|ZP_05582808.1| ATPase [Enterococcus faecalis CH188]
 gi|257417389|ref|ZP_05594383.1| ATPase [Enterococcus faecalis AR01/DG]
 gi|257418874|ref|ZP_05595868.1| ATPase [Enterococcus faecalis T11]
 gi|257421311|ref|ZP_05598301.1| ATPase [Enterococcus faecalis X98]
 gi|293384808|ref|ZP_06630653.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           R712]
 gi|293388230|ref|ZP_06632749.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           S613]
 gi|294781215|ref|ZP_06746562.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           PC1.1]
 gi|300861497|ref|ZP_07107581.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TUSoD Ef11]
 gi|307268878|ref|ZP_07550243.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX4248]
 gi|307273953|ref|ZP_07555163.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0855]
 gi|307277346|ref|ZP_07558444.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX2134]
 gi|307284002|ref|ZP_07564172.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0860]
 gi|307289975|ref|ZP_07569901.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0411]
 gi|312901335|ref|ZP_07760616.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0470]
 gi|312902982|ref|ZP_07762171.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0635]
 gi|312908850|ref|ZP_07767789.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           DAPTO 512]
 gi|312952968|ref|ZP_07771824.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0102]
 gi|312979507|ref|ZP_07791189.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           DAPTO 516]
 gi|29345208|gb|AAO82964.1| ATPase, ParA family [Enterococcus faecalis V583]
 gi|227074413|gb|EEI12376.1| chromosome partitioning ATPase [Enterococcus faecalis TX0104]
 gi|227175226|gb|EEI56198.1| chromosome partitioning ATPase [Enterococcus faecalis HH22]
 gi|229304168|gb|EEN70164.1| chromosome partitioning ATPase [Enterococcus faecalis ATCC 29200]
 gi|229307747|gb|EEN73734.1| chromosome partitioning ATPase [Enterococcus faecalis TX1322]
 gi|255962534|gb|EET95010.1| ATPase [Enterococcus faecalis T1]
 gi|255967338|gb|EET97960.1| ATPase [Enterococcus faecalis T2]
 gi|256598088|gb|EEU17264.1| ATPase [Enterococcus faecalis ATCC 4200]
 gi|256683072|gb|EEU22767.1| ATPase [Enterococcus faecalis T3]
 gi|256709461|gb|EEU24508.1| ParaA family ATPase [Enterococcus faecalis T8]
 gi|256947545|gb|EEU64177.1| ATPase [Enterococcus faecalis DS5]
 gi|256951409|gb|EEU68041.1| ATPase [Enterococcus faecalis Merz96]
 gi|256954445|gb|EEU71077.1| ATPase [Enterococcus faecalis HIP11704]
 gi|256986756|gb|EEU74058.1| ParaA family ATPase [Enterococcus faecalis JH1]
 gi|256989344|gb|EEU76646.1| ParaA family ATPase [Enterococcus faecalis E1Sol]
 gi|256992002|gb|EEU79304.1| ParaA family ATPase [Enterococcus faecalis Fly1]
 gi|256995832|gb|EEU83134.1| ATPase [Enterococcus faecalis D6]
 gi|256997259|gb|EEU83779.1| ATPase [Enterococcus faecalis CH188]
 gi|257159217|gb|EEU89177.1| ATPase [Enterococcus faecalis ARO1/DG]
 gi|257160702|gb|EEU90662.1| ATPase [Enterococcus faecalis T11]
 gi|257163135|gb|EEU93095.1| ATPase [Enterococcus faecalis X98]
 gi|291077890|gb|EFE15254.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           R712]
 gi|291082377|gb|EFE19340.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           S613]
 gi|294451678|gb|EFG20133.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           PC1.1]
 gi|295112316|emb|CBL30953.1| chromosome segregation ATPase [Enterococcus sp. 7L76]
 gi|300848958|gb|EFK76711.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TUSoD Ef11]
 gi|306498969|gb|EFM68461.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0411]
 gi|306503373|gb|EFM72622.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0860]
 gi|306505980|gb|EFM75152.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX2134]
 gi|306509261|gb|EFM78321.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0855]
 gi|306514794|gb|EFM83344.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX4248]
 gi|310625288|gb|EFQ08571.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           DAPTO 512]
 gi|310629109|gb|EFQ12392.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0102]
 gi|310633650|gb|EFQ16933.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0635]
 gi|311287689|gb|EFQ66245.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           DAPTO 516]
 gi|311291568|gb|EFQ70124.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0470]
 gi|315026605|gb|EFT38537.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX2137]
 gi|315030099|gb|EFT42031.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX4000]
 gi|315033592|gb|EFT45524.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0017]
 gi|315036257|gb|EFT48189.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0027]
 gi|315143571|gb|EFT87587.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX2141]
 gi|315148290|gb|EFT92306.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX4244]
 gi|315151255|gb|EFT95271.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0012]
 gi|315153740|gb|EFT97756.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0031]
 gi|315155034|gb|EFT99050.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0043]
 gi|315158677|gb|EFU02694.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0312]
 gi|315163400|gb|EFU07417.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0645]
 gi|315165661|gb|EFU09678.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX1302]
 gi|315168467|gb|EFU12484.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX1341]
 gi|315172085|gb|EFU16102.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX1342]
 gi|315174218|gb|EFU18235.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX1346]
 gi|315576180|gb|EFU88371.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0309B]
 gi|315579759|gb|EFU91950.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0630]
 gi|315582991|gb|EFU95182.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0309A]
 gi|323479206|gb|ADX78645.1| chromosome partitioning ATPase [Enterococcus faecalis 62]
 gi|327536397|gb|AEA95231.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           OG1RF]
 gi|329577028|gb|EGG58503.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX1467]
          Length = 253

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA +G+ VLLID+D QGNA++G+G+   D  +  Y
Sbjct: 2   TRIISVANQKGGVGKTTTTVNLGACLANLGKKVLLIDIDAQGNATSGMGVPKPDVAHDVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+ I  ++  T+  NL I+P+T+ L G E+ L     R  RL  A+  ++   + 
Sbjct: 62  DVLVNEEPITSVVQHTSRENLDIVPATIQLAGAEIELTSMMARESRLKLAID-EVRDMYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL T+  V++  N  L I+G
Sbjct: 121 FVLIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTIRLVQKHFNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VRK    KVY+T+IPRNVR+SEAPS+G P I YD++  G++
Sbjct: 181 VLLTMYDARTNLGAEVVEEVRKYFREKVYDTIIPRNVRLSEAPSHGLPIIDYDIRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E+++ E
Sbjct: 241 VYQALAKEVLENE 253


>gi|227511971|ref|ZP_03942020.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus buchneri ATCC 11577]
 gi|227084779|gb|EEI20091.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus buchneri ATCC 11577]
          Length = 255

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 175/250 (70%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S +I +ANQKGGVGKTTTA+NL   LA++G+ +LL+D D QGNA++G+GI   D     Y
Sbjct: 2   SHVIALANQKGGVGKTTTAVNLGAGLASLGKKILLVDADAQGNATSGVGISKADIGKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+++ + ++ TA   L I+P+T+ L G E+ L  +  R  RL  AL   +   + 
Sbjct: 62  DVLVNEESMQEAIVHTAHEGLDIVPATIQLSGAEIELTPQMARETRLKAALD-DVKDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  L+T+NA  A+DSIL+P+Q E++ALEGLSQLL T++ VR+  N  L I+G
Sbjct: 121 YVLIDCPPSLGLITINAFTASDSILIPVQSEYYALEGLSQLLNTIQLVRKHFNPDLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV  +VRK    +VY TVIPRNVR+SEAPSYG P + YD K  G+ 
Sbjct: 181 VLLTMFDARTNLGVQVNQEVRKYFKNEVYETVIPRNVRLSEAPSYGLPIMDYDPKSKGAD 240

Query: 246 AYLKLASELI 255
            Y+KLA E++
Sbjct: 241 KYMKLAKEVL 250


>gi|227524956|ref|ZP_03955005.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus hilgardii ATCC 8290]
 gi|227087868|gb|EEI23180.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus hilgardii ATCC 8290]
          Length = 255

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 176/250 (70%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S +I +ANQKGGVGKTTTA+NL   LA++G+ +LL+D D QGNA++G+GI   D     Y
Sbjct: 2   SHVIALANQKGGVGKTTTAVNLGAGLASLGKKILLVDADAQGNATSGVGISKADIGKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L++E+++ + ++ TA   L I+P+T+ L G E+ L  +  R  RL  AL   +   + 
Sbjct: 62  DVLVDEESMQEAIVHTANEGLDIVPATIQLSGAEIELTPQMARETRLKAALD-DVKDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  L+T+NA  A+DSIL+P+Q E++ALEGLSQLL T++ VR+  N  L I+G
Sbjct: 121 YVLIDCPPSLGLITINAFTASDSILIPVQSEYYALEGLSQLLNTIQLVRKHFNPDLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV  +VRK    +VY TVIPRNVR+SEAPSYG P + YD K  G+ 
Sbjct: 181 VLLTMFDARTNLGVQVNQEVRKYFKNEVYETVIPRNVRLSEAPSYGLPIMDYDPKSKGAD 240

Query: 246 AYLKLASELI 255
            Y+KLA E++
Sbjct: 241 KYMKLAKEVL 250


>gi|77166529|ref|YP_345054.1| cobyrinic acid a,c-diamide synthase [Nitrosococcus oceani ATCC
           19707]
 gi|254435561|ref|ZP_05049068.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative
           [Nitrosococcus oceani AFC27]
 gi|76884843|gb|ABA59524.1| chromosome segregation ATPase [Nitrosococcus oceani ATCC 19707]
 gi|207088672|gb|EDZ65944.1| CobQ/CobB/MinD/ParA nucleotide binding domain, putative
           [Nitrosococcus oceani AFC27]
          Length = 264

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 177/252 (70%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
            II I NQKGGVGKTTT++NL+ +LAA   NVLLID+DPQGNA+TG GI+      ++YD
Sbjct: 3   HIIAITNQKGGVGKTTTSVNLAASLAAHKRNVLLIDMDPQGNATTGSGIDKSSLLATTYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+E+      LI+   PN +++P+  DL   E+ L     R  RL  AL  ++  D+  
Sbjct: 63  VLLEDLAPGSALIKLGEPNYTVLPANADLTAAEVELLSAAKREHRLRIALQ-KIRYDYDE 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ N+LT+NA+ AAD +++P+QCE++ALEGLS LL T+E +R+ +N  L I G+
Sbjct: 122 ILIDCPPALNMLTINALTAADGVVIPIQCEYYALEGLSALLNTIEGIRQRLNPQLHIAGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN+L+ +V S +  + G +VY+T+IPRNVR++EAPSYGKP ++YD    GS A
Sbjct: 182 LRTMFDPRNNLANEVSSQLMSHFGEQVYSTIIPRNVRLAEAPSYGKPVMLYDRSSRGSVA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++ +E
Sbjct: 242 YLVLAKEVLMRE 253


>gi|307265448|ref|ZP_07547004.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326390373|ref|ZP_08211932.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|306919562|gb|EFN49780.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325993650|gb|EGD52083.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 255

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT INL  +LA  G+ VL ID+DPQ N ++G GI     K+++Y 
Sbjct: 3   KVIAIANQKGGVGKTTTTINLGYSLAVQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIEE++I   +I      +SI+PS++ L G E+ L     R ++L  A++ Q+   F Y
Sbjct: 63  VLIEEEDIRNAIIYLNDLKVSIVPSSIQLAGAEIELVPMLSREYKLKNAVN-QIKDGFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N  L+I+G+
Sbjct: 122 ILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPELEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPS+GKP  IYD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKDKVYRTIIPRNIRLGEAPSFGKPISIYDPNSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y +LA E+I++
Sbjct: 242 YDELALEVIER 252


>gi|116329510|ref|YP_799230.1| ParA-like protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116329825|ref|YP_799543.1| ParA-like protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116122254|gb|ABJ80297.1| ParA-like protein [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116123514|gb|ABJ74785.1| ParA-like protein [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 253

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 184/248 (74%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I++I+NQKGGVGKTTT+INL+  LA+IG+ VL+ID+DPQGN+ +GLGIE+     +SY+
Sbjct: 3   KIVSISNQKGGVGKTTTSINLAANLASIGKKVLIIDMDPQGNSGSGLGIEINTLVKTSYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E + N+ + +T + NL IIPS ++L G E  L  E  R +RL  A+S +L S++ Y
Sbjct: 63  LLLGESSTNECIQRTNVSNLHIIPSNINLSGAEADLLVEDQREYRLKNAVS-ELRSEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+NA+ AADS+++ LQ E+FALEGL+QL++ +  V+  +N +L+++G+
Sbjct: 122 ILIDCPPSLGILTINALCAADSVMITLQTEYFALEGLTQLMKIISLVQNQLNPSLELEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +L+ QV  DV+     KVY T+IPRNV++SEAPS+G+  + YD +  G+Q+
Sbjct: 182 LLTMFDKRTNLANQVAEDVKSYFKDKVYTTIIPRNVKLSEAPSFGQTIMSYDPEGVGAQS 241

Query: 247 YLKLASEL 254
           Y  LA E+
Sbjct: 242 YRSLALEV 249


>gi|325832237|ref|ZP_08165236.1| sporulation initiation inhibitor protein Soj [Eggerthella sp. HGA1]
 gi|325486073|gb|EGC88527.1| sporulation initiation inhibitor protein Soj [Eggerthella sp. HGA1]
          Length = 323

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           +++++ I NQKGGVGK+TTAINLS AL  +G+ VLL+DLDPQGN+S+GLGIE        
Sbjct: 71  QTKVMAIINQKGGVGKSTTAINLSAALGELGKQVLLVDLDPQGNSSSGLGIEKSQVHNCV 130

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           YD+L+ +  I  ++I      L ++P+T++L G E+ L  E  R  RL  A+   L   +
Sbjct: 131 YDVLLNDVAIEDVIIPDVGEGLDLVPATINLAGAEVELVSEMARENRLKDAVG-SLRGKY 189

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LL++++ V+  +N  LDI 
Sbjct: 190 DYVFIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLDSMKRVKTRLNPTLDIF 249

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D R +LS+QVV +VR   G  V+ T+IPR V++SEAPS+G+P   YD    G+
Sbjct: 250 GVLLTMYDGRTTLSRQVVEEVRSYFGKTVFTTLIPRTVKLSEAPSFGQPITQYDPSGKGA 309

Query: 245 QAYLKLASELIQQ 257
           Q+Y+ LA E++Q+
Sbjct: 310 QSYVNLAKEVVQR 322


>gi|323141497|ref|ZP_08076385.1| sporulation initiation inhibitor protein Soj [Phascolarctobacterium
           sp. YIT 12067]
 gi|322414013|gb|EFY04844.1| sporulation initiation inhibitor protein Soj [Phascolarctobacterium
           sp. YIT 12067]
          Length = 253

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTA+NL+  LA++   VLLID DPQGNA++G G +  D K   YD
Sbjct: 3   KVIAIANQKGGVGKTTTAVNLAACLASLERKVLLIDSDPQGNATSGFGFDKRDIKQCIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            +I +  +  ++  TA   L ++P+T+ L G E+ L    +R  RL  +L  ++  ++ Y
Sbjct: 63  AIISDVPMQDVIKHTAYKGLDLVPATIQLAGAEIELVSLMNREGRLKNSLE-RVKHNYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+N + AA S+++P+QCEF+ALEG++ L+ T++ V+R +N AL ++G+
Sbjct: 122 VIIDCPPSLGLLTINGLTAASSVMIPIQCEFYALEGVTMLMNTIQLVQRNLNPALKLEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TM+DSR +LSQ VV++V+K    K+Y T+IPRNVR+SEAPS+G+P I YD K  G+Q 
Sbjct: 182 LMTMYDSRTNLSQDVVNEVQKYFKTKMYQTIIPRNVRLSEAPSHGQPVIDYDSKSKGAQV 241

Query: 247 YLKLASELIQQE 258
           Y+  A E+I+ E
Sbjct: 242 YMDFAREVIEDE 253


>gi|221195003|ref|ZP_03568059.1| SpoOJ regulator protein [Atopobium rimae ATCC 49626]
 gi|221184906|gb|EEE17297.1| SpoOJ regulator protein [Atopobium rimae ATCC 49626]
          Length = 266

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 185/255 (72%), Gaps = 1/255 (0%)

Query: 3   EKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62
           EK  ++I I NQKGGVGK+TTA+NL+ AL    + VLLID DPQGNA++G GIE  + ++
Sbjct: 12  EKDCKVIAIINQKGGVGKSTTAVNLTAALGETKKKVLLIDFDPQGNATSGYGIEKEELEH 71

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
             YD+++ E +I  +++ T    + ++P+T+ L G E+ L  +++R + L KA+  ++  
Sbjct: 72  DIYDVILNEYSIKDLILPTPEERVFVVPATIQLAGAEIELVNKENREYVLKKAIE-EVKD 130

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           +F Y+F+DCPPS  LLT+NA  AADS+LVP+QCE++ALEG+S+LLE++  V+  +N  L+
Sbjct: 131 EFDYVFIDCPPSLGLLTINAFVAADSLLVPIQCEYYALEGVSKLLESMAMVQSNLNPDLE 190

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           + G+++TMFDSR +LS+QVV +V    G K++ T+IPRN++I+EAPS+G P  +Y     
Sbjct: 191 VFGVVMTMFDSRTTLSKQVVEEVSNYFGNKMFKTLIPRNIKIAEAPSHGLPISMYARISK 250

Query: 243 GSQAYLKLASELIQQ 257
           GS AY+KLA E+I++
Sbjct: 251 GSLAYVKLAKEVIRR 265


>gi|260881802|ref|ZP_05405253.2| ParA family protein [Mitsuokella multacida DSM 20544]
 gi|260847921|gb|EEX67928.1| ParA family protein [Mitsuokella multacida DSM 20544]
          Length = 325

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 180/253 (71%), Gaps = 2/253 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K++II +ANQKGGVGKTTT++NL+  LAA  + VLL+D DPQGNAS+G GI+      + 
Sbjct: 73  KAKIIAVANQKGGVGKTTTSVNLAACLAAKEKKVLLVDCDPQGNASSGYGIDKSVLATTI 132

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y ++I    +   +I+T    + ++P+ ++L G E+ L     R  RL +AL   +  D+
Sbjct: 133 YQVIINGAAVQDAIIKTEF-GVDVLPANIELAGAEVELVAAISRETRLKRALE-PVEQDY 190

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS  LLT+N++AAADS+L+P+QCEF+ALEG+SQL+ T+E VR  +N  L+++
Sbjct: 191 DYILIDCPPSLGLLTLNSLAAADSVLMPIQCEFYALEGVSQLMNTIELVRTNLNPHLEVE 250

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+++TM+D R  L++QVV++VR+N G  VY T+IPR VR+SEAPSYG+P + YD +  G+
Sbjct: 251 GVLMTMYDGRTRLAEQVVAEVRENFGELVYKTMIPRTVRLSEAPSYGEPILYYDKRSKGT 310

Query: 245 QAYLKLASELIQQ 257
             Y+KLA E++  
Sbjct: 311 DTYMKLAEEVMAH 323


>gi|307286502|ref|ZP_07566601.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0109]
 gi|306502375|gb|EFM71652.1| sporulation initiation inhibitor protein Soj [Enterococcus faecalis
           TX0109]
          Length = 253

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA +G+ VLLID+D QGNA++G+G+   D  +  Y
Sbjct: 2   TRIISVANQKGGVGKTTTTVNLGACLANLGKKVLLIDIDAQGNATSGMGVPKPDVAHDVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+ I  ++  T+  NL I+P+T+ L G E+ L     R  RL  A+  ++   + 
Sbjct: 62  DVLVNEEPITSVVQHTSRENLDIVPATIQLAGAEIELTSMMARESRLKLAID-EVRDMYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL T+  V++  N  L I+G
Sbjct: 121 FVLIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTIRLVQKHFNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VRK    KVY+T+IPRN+R+SEAPS+G P I YD++  G++
Sbjct: 181 VLLTMYDARTNLGAEVVEEVRKYFREKVYDTIIPRNIRLSEAPSHGLPIIDYDIRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E+++ E
Sbjct: 241 VYQALAKEVLENE 253


>gi|291278559|ref|YP_003495394.1| chromosome partitioning protein ParA [Deferribacter desulfuricans
           SSM1]
 gi|290753261|dbj|BAI79638.1| chromosome partitioning protein ParA [Deferribacter desulfuricans
           SSM1]
          Length = 253

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 184/251 (73%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTTA+NLS+ALA     VL++D+DPQ NA++GLG   ++ + S YD
Sbjct: 3   KIIAVANQKGGVGKTTTAVNLSSALAIAEAKVLIVDMDPQANATSGLGYLPHELEKSVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            ++ + ++++I+++T I NL ++PS +DL   E+ L     R  RL K L ++   DF +
Sbjct: 63  AIVGDVSLDEIILETQINNLYLVPSKIDLTAAEIELVTVLSRETRLKKHLDMK-KDDFDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ AAD++L+PLQCE++ALEGLSQLL TV  +R  +N  L ++GI
Sbjct: 122 IIIDCPPSLGLLTINSLTAADTVLIPLQCEYYALEGLSQLLNTVRLIRENLNPELKLEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D RN+LS++V   VR+     ++ T+IPRNV++SEAPS+G P I YD++  G+++
Sbjct: 182 LLTMYDPRNNLSKEVYRQVREYFREDMFRTIIPRNVKLSEAPSHGLPIISYDIRSKGAES 241

Query: 247 YLKLASELIQQ 257
           Y++LA E+I +
Sbjct: 242 YIELAKEVISR 252


>gi|297539952|ref|YP_003675721.1| Cobyrinic acid ac-diamide synthase [Methylotenera sp. 301]
 gi|297259299|gb|ADI31144.1| Cobyrinic acid ac-diamide synthase [Methylotenera sp. 301]
          Length = 261

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 184/259 (71%), Gaps = 4/259 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ I NQKGGVGKTTT +NL+ +LA++G+ VLLIDLDPQGNASTG GI+    K+S Y 
Sbjct: 2   KILAITNQKGGVGKTTTCVNLAASLASLGKRVLLIDLDPQGNASTGSGIDKAHLKFSIYH 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLD----KALSVQLTS 122
           +LI EK++ ++++ +      I PS  DL G E+ L  E  R  RL     K +S +  +
Sbjct: 62  VLIGEKSLKEVILTSEKGGFDIAPSNRDLAGAEVELVNELARENRLKVAIAKLVSAEEAA 121

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + ++ LDCPP+ NL+T+NA+ A+ ++++P+QCE++ALEGLS L+ T+++VR  +N  L+
Sbjct: 122 PYDFVLLDCPPALNLVTVNALTASSAVMIPMQCEYYALEGLSDLVNTIKKVRARLNPTLE 181

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+G++ T+FD+RN L+QQV + +  + G KVY T+IPRN+R++EAPSYG P + YD    
Sbjct: 182 IEGLLRTLFDNRNMLAQQVSAQLISHFGDKVYKTIIPRNIRLAEAPSYGVPVLNYDKASK 241

Query: 243 GSQAYLKLASELIQQERHR 261
           G+ AYL+LA E+++ ++  
Sbjct: 242 GAVAYLELAKEVMRSDKKH 260


>gi|317489235|ref|ZP_07947752.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Eggerthella sp. 1_3_56FAA]
 gi|316911636|gb|EFV33228.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Eggerthella sp. 1_3_56FAA]
          Length = 294

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           +++++ I NQKGGVGK+TTAINLS AL  +G+ VLL+DLDPQGN+S+GLGIE        
Sbjct: 42  QTKVMAIINQKGGVGKSTTAINLSAALGELGKQVLLVDLDPQGNSSSGLGIEKSQVHNCV 101

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           YD+L+ +  I  ++I      L ++P+T++L G E+ L  E  R  RL  A+   L   +
Sbjct: 102 YDVLLNDVAIEDVIIPDVGEGLDLVPATINLAGAEVELVSEMARENRLKDAVG-SLRGKY 160

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LL++++ V+  +N  LDI 
Sbjct: 161 DYVFIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLDSMKRVKTRLNPTLDIF 220

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D R +LS+QVV +VR   G  V+ T+IPR V++SEAPS+G+P   YD    G+
Sbjct: 221 GVLLTMYDGRTTLSRQVVEEVRSYFGKTVFTTLIPRTVKLSEAPSFGQPITQYDPSGKGA 280

Query: 245 QAYLKLASELIQQ 257
           Q+Y+ LA E++Q+
Sbjct: 281 QSYVNLAKEVVQR 293


>gi|227529770|ref|ZP_03959819.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus vaginalis ATCC 49540]
 gi|227350254|gb|EEJ40545.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus vaginalis ATCC 49540]
          Length = 256

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 179/253 (70%), Gaps = 3/253 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G+ VLLIDLDPQGNA++GLGI+  D   S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLADAGKKVLLIDLDPQGNATSGLGIDKKDIDESVYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI + ++  +++ ++   L I+P+T+ L G E+ L     R  RL  A    +  ++ YI
Sbjct: 64  LINDVDLKNVILPSSHQGLDIVPTTIALSGAEVELTNLMARETRLKDAFG-DVKDEYDYI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  A DSIL+P+Q E++ALEGLSQLL T++ VR+  NSAL I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVRKHFNSALKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM+D R +L QQV ++V+K  G +VY T+IPRNVR+SEAPS+G+  + YD +  G++ Y
Sbjct: 183 LTMYDKRTNLGQQVNAEVKKYFGDQVYETIIPRNVRLSEAPSHGQAIVDYDKRSTGAKVY 242

Query: 248 LKLASELIQQERH 260
            +LA E++   RH
Sbjct: 243 QQLAKEVLA--RH 253


>gi|297563777|ref|YP_003682751.1| cobyrinic acid ac-diamide synthase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296848225|gb|ADH70245.1| Cobyrinic acid ac-diamide synthase [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 317

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 125/257 (48%), Positives = 173/257 (67%), Gaps = 1/257 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K+ R+I++ANQKGGVGKTTT +N++ ALA  G+ VL++DLDPQGNAST L +E  ++  S
Sbjct: 60  KECRVISVANQKGGVGKTTTTVNIAAALAMHGQRVLVVDLDPQGNASTALSMERDNQTRS 119

Query: 64  SYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
            Y  L+E++ I ++      IPNL   P+T+DL G E+ L     R  RL +A +   TS
Sbjct: 120 IYHCLVEDEEIRKLAQPVPEIPNLWCAPATIDLAGAEIELVSLVAREARLKRAFAAYDTS 179

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           D  YI +DCPPS  LLT+NAM A D +++P+QCE++ALEGL QLL  VE V+  +N  L 
Sbjct: 180 DLDYILIDCPPSLGLLTVNAMVACDEVMIPIQCEYYALEGLGQLLRNVELVQSHLNPGLA 239

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           +  I+LTM+D R  LSQQV  +VR + G  V  T+IPR+VR+SEAPSYG+  + YD    
Sbjct: 240 VSTILLTMYDGRTRLSQQVADEVRSHFGDTVLETLIPRSVRVSEAPSYGQSVMTYDPAST 299

Query: 243 GSQAYLKLASELIQQER 259
           G+ AYL+ A E+  + +
Sbjct: 300 GAVAYLEAAREIAHRAK 316


>gi|257792842|ref|YP_003183448.1| Cobyrinic acid ac-diamide synthase [Eggerthella lenta DSM 2243]
 gi|257476739|gb|ACV57059.1| Cobyrinic acid ac-diamide synthase [Eggerthella lenta DSM 2243]
          Length = 294

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/253 (47%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           +++++ I NQKGGVGK+TTAINLS AL  +G+ VLL+DLDPQGN+S+GLGIE        
Sbjct: 42  QTKVMAIINQKGGVGKSTTAINLSAALGELGKQVLLVDLDPQGNSSSGLGIEKSQVHNCV 101

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           YD+L+ +  I  ++I      L ++P+T++L G E+ L  E  R  RL  A+   L   +
Sbjct: 102 YDVLLNDVAIEDVIIPDVGEGLDLVPATINLAGAEVELVSEMARENRLKDAVG-SLRGKY 160

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LL++++ V+  +N  LDI 
Sbjct: 161 DYVFIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLDSMKRVKTRLNPTLDIF 220

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D R +LS+QVV +VR   G  V+ T+IPR V++SEAPS+G+P   YD    G+
Sbjct: 221 GVLLTMYDGRTTLSRQVVEEVRSYFGKTVFTTLIPRTVKLSEAPSFGQPITQYDPSGKGA 280

Query: 245 QAYLKLASELIQQ 257
           Q+Y+ LA E++Q+
Sbjct: 281 QSYVNLAKEVVQR 293


>gi|262197766|ref|YP_003268975.1| cobyrinic acid ac-diamide synthase [Haliangium ochraceum DSM 14365]
 gi|262081113|gb|ACY17082.1| Cobyrinic acid ac-diamide synthase [Haliangium ochraceum DSM 14365]
          Length = 279

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 174/252 (69%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I +ANQKGGVGKTTTAINLS ++A+ G  VLL+D DPQGNAS+G+G      + S Y
Sbjct: 8   ARVIAVANQKGGVGKTTTAINLSASVASRGHRVLLVDFDPQGNASSGVGYPKSRVELSVY 67

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D L  E  +   +  T I  L ++P+TMDL+G E+ L   + R  R+       + + + 
Sbjct: 68  DALTGEVAMRDCVRPTEITTLFVVPATMDLVGAELELITAEGR-ERVLADALADVAASYD 126

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+D ++VP+Q E+FALEGLS L+ T+ +VR   N  L I+G
Sbjct: 127 YIVIDCPPSLGLLTLNALVASDGVVVPMQAEYFALEGLSALMATIAKVREVYNPKLQIEG 186

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++  M+D R +LS QV  +V  +LG KV++T IPRNVR+SE+PS+GKP ++YDL+C GS+
Sbjct: 187 VLFCMYDPRTNLSGQVRGEVTDHLGSKVFDTAIPRNVRLSESPSHGKPVMLYDLRCPGSK 246

Query: 246 AYLKLASELIQQ 257
           +YL LA E + +
Sbjct: 247 SYLALAEEFLSR 258


>gi|59713180|ref|YP_205956.1| chromosome partitioning protein ParA [Vibrio fischeri ES114]
 gi|197334095|ref|YP_002157360.1| sporulation initiation inhibitor protein soj [Vibrio fischeri MJ11]
 gi|59481281|gb|AAW87068.1| chromosome partitioning protein ParA [Vibrio fischeri ES114]
 gi|197315585|gb|ACH65032.1| sporulation initiation inhibitor protein soj [Vibrio fischeri MJ11]
          Length = 265

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+IANQKGGVGKTTTA+NL+ ++AA    VLLIDLD QGNA+   G++ YD   ++Y+
Sbjct: 3   KIISIANQKGGVGKTTTAVNLAASMAATHRKVLLIDLDAQGNATMASGVDKYDVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++E   ++++I+       +I +  D+   E+ L     R  RL + +   +  ++ +
Sbjct: 63  LLVDEVPFDKVVIEETSGGYDLIAANGDVTAAEIKLMEVFAREVRL-RNMIYPIRGNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAMAA+DS+LVP+QCE++ALEGL+ L++T+ ++   VN+ L I+G+
Sbjct: 122 IFIDCPPALNLLTINAMAASDSVLVPMQCEYYALEGLTALIDTIGKLAAVVNADLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+  V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD    G++A
Sbjct: 182 LRTMFDPRNRLANDVSDQLKKHFGEKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSNGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+I+++   KE
Sbjct: 242 YLALAGEIIRRDEMEKE 258


>gi|312144695|ref|YP_003996141.1| cobyrinic acid ac-diamide synthase [Halanaerobium sp.
           'sapolanicus']
 gi|311905346|gb|ADQ15787.1| cobyrinic acid ac-diamide synthase [Halanaerobium sp.
           'sapolanicus']
          Length = 253

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 182/250 (72%), Gaps = 1/250 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I I NQKGGVGK+TTA+NL   LA  G  VL+ID+DPQGNA++GLGIE  + +++ YDLL
Sbjct: 5   IAIVNQKGGVGKSTTAVNLGAGLAENGLKVLIIDIDPQGNATSGLGIEKSEAEHTIYDLL 64

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
           IE +  ++ ++++A  NL +IP+ ++L G E+ L     R  RL K+L ++++  + Y+ 
Sbjct: 65  IESEPASKAIVKSASKNLDLIPANIELAGAEIELVSIISRESRLKKSL-LEISDHYDYVI 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL QL+ T+E VR+ +N  L I+G+++
Sbjct: 124 IDCPPSLGLLTLNALTAADSVMVPIQCEYYALEGLGQLMNTIELVRKNLNPDLRIEGVLM 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TM+D+R +LSQQV+ +V+      ++ T+IPRNVR+SEAPS+G+  + Y     G++AY 
Sbjct: 184 TMYDARTNLSQQVIEEVKDYFSELLFKTIIPRNVRLSEAPSFGQTILDYSSNSKGAKAYR 243

Query: 249 KLASELIQQE 258
           KLA E+I  E
Sbjct: 244 KLAEEVISSE 253


>gi|209696452|ref|YP_002264383.1| chromosome partitioning protein, sporulation initiation inhibitor
           protein Soj [Aliivibrio salmonicida LFI1238]
 gi|208010406|emb|CAQ80752.1| chromosome partitioning protein, sporulation initiation inhibitor
           protein Soj [Aliivibrio salmonicida LFI1238]
          Length = 265

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I+IANQKGGVGKTTTA+NL+ ++AA    VLLIDLD QGNA+   G++ YD   ++Y+
Sbjct: 3   RVISIANQKGGVGKTTTAVNLAASMAATNRKVLLIDLDAQGNATMASGVDKYDVDATAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++E   ++++I+       +I +  D+   E+ L     R  RL + +   +  ++ +
Sbjct: 63  LLVDEVPFDKVVIEETSGGYDLIAANGDITAAEIKLMEVFAREVRL-RNMIYPVRGNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ NLLT+NAMAA+DS+LVP+QCE++ALEGL+ L++T+ ++   VN+ L I+G+
Sbjct: 122 IFIDCPPALNLLTINAMAASDSVLVPMQCEYYALEGLTALIDTISKLAAVVNADLKIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++K+ G KVY TVIPRNVR++EAPS+GKPA+ YD    G++A
Sbjct: 182 LRTMYDPRNRLANDVSDQLKKHFGDKVYRTVIPRNVRLAEAPSHGKPAMYYDKYSNGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E+I+++   KE
Sbjct: 242 YLALAGEIIRRDELEKE 258


>gi|86134027|ref|ZP_01052609.1| ATPase, ParA family [Polaribacter sp. MED152]
 gi|85820890|gb|EAQ42037.1| ATPase, ParA family [Polaribacter sp. MED152]
          Length = 254

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NAS+GLGI++   +Y +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVEAVEYGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L    +    ++ T+ PN+ IIP+ +DL+ IE+ L  +++R + L K++   L +++ Y
Sbjct: 63  VLEHTISAKDAIVSTSSPNVDIIPAHIDLVAIEIELVDKQEREYMLKKSIEA-LKNEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+N++ AADS+++P+QCE+FALEGL +LL T++ V++  N+ LDI+G+
Sbjct: 122 IIIDCAPSLGLITLNSLVAADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNADLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +VRK+    V+NT+I RN R+ EAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVDEVRKHFSSMVFNTIIRRNTRLGEAPSYGESIIAYDATSKGAVN 241

Query: 247 YLKLASELIQQ 257
           YL LA EL+++
Sbjct: 242 YLNLAQELLKK 252


>gi|326692158|ref|ZP_08229163.1| chromosome partitioning protein, membrane-associated ATPase
           [Leuconostoc argentinum KCTC 3773]
          Length = 253

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 182/252 (72%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT++NL  ALA  G+ VLL+D+D QGNA++G GI+  + +  SY
Sbjct: 2   AQIIALANQKGGVGKTTTSVNLGAALAQAGQRVLLVDIDAQGNATSGSGIDKSELERDSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++++   ++++++ T   N  ++P+T+ L G E+ L  +K+R +RL  AL+  +  D+ 
Sbjct: 62  DVIVDGAPLHEVIVPT--DNYDLVPATIQLSGAEIELADKKEREYRLKAALAT-VADDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  LLT+NA  AAD+IL+P+Q EF+ALEGL QLL T+E VR+  N  LDI G
Sbjct: 119 FILIDNPPALGLLTVNAFTAADAILIPVQTEFYALEGLGQLLNTIELVRQQFNPDLDIAG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR   G KVY TVIPR VR+SEAPSYG+  I +D +  G+Q
Sbjct: 179 ILLTMYDGRTNLAKQVAEEVRNYFGDKVYETVIPRTVRLSEAPSYGQAIIDFDPRSVGAQ 238

Query: 246 AYLKLASELIQQ 257
            Y +LA E+++Q
Sbjct: 239 VYTELAQEVLKQ 250


>gi|225575636|ref|ZP_03784246.1| hypothetical protein RUMHYD_03729 [Blautia hydrogenotrophica DSM
           10507]
 gi|225037146|gb|EEG47392.1| hypothetical protein RUMHYD_03729 [Blautia hydrogenotrophica DSM
           10507]
          Length = 256

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 182/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I IANQKGGVGK+TTAINLS  LA  G+ VL +D+DPQGN ++GLG +    +Y+ Y+
Sbjct: 3   RTIAIANQKGGVGKSTTAINLSACLAEAGKRVLTVDIDPQGNTTSGLGTDKNGVEYTLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ + +    +I+  +  + +IPS ++L G E+ L G ++R + L   L  ++   + Y
Sbjct: 63  LLLGDCDPKDCIIENVVERVDLIPSNVNLSGAEIELVGIEEREYILKNVLE-RIKEGYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NA+ AADS+LVP+QCE++ALEGLSQL+ T+E V+  +N  L+I+G+
Sbjct: 122 IIMDCPPSLSMLTINALTAADSVLVPIQCEYYALEGLSQLIHTIELVQERLNKKLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV +V++NL   +Y T+IPRNVR++EAPSYG P  +YD K  G+++
Sbjct: 182 VFTMYDARTNLSLEVVENVKENLNQNIYKTIIPRNVRLAEAPSYGLPINMYDPKSTGAES 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I +E
Sbjct: 242 YRLLAEEVINRE 253


>gi|320352147|ref|YP_004193486.1| chromosome segregation ATPase [Desulfobulbus propionicus DSM 2032]
 gi|320120649|gb|ADW16195.1| chromosome segregation ATPase [Desulfobulbus propionicus DSM 2032]
          Length = 258

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 184/256 (71%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + II +ANQKGGVGKTTTA+NL+  LA  G+ VLL+D DPQGNAS+G+G+   +   + Y
Sbjct: 3   THIIALANQKGGVGKTTTALNLAAVLADKGKKVLLVDSDPQGNASSGVGLFNTNEDKNIY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
                 K     ++ T   NLSI+P+++DL+G+E+ L  +++R  RL KAL   +   F 
Sbjct: 63  SCYTGAKEAVDCILPTKQKNLSILPASIDLVGVEVELISQENREKRL-KALLRPVREQFH 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  +LT+N++ AADS+L+P+QCE+FA+EGL+QL++T+ +V++T+N  L ++G
Sbjct: 122 YILIDCPPSLGMLTINSLTAADSVLIPMQCEYFAMEGLAQLIQTIRKVKKTLNRELYVEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN L+  V S+++K+ G +VY TVIPRNVR+SE+PS+G+  I YD    G++
Sbjct: 182 LLLTMYDRRNRLTHSVASEIQKHFGDQVYKTVIPRNVRLSESPSHGQTIIEYDPGSTGAK 241

Query: 246 AYLKLASELIQQERHR 261
           AY +L  E +++ + R
Sbjct: 242 AYRQLGGEFLKRTKAR 257


>gi|300173933|ref|YP_003773099.1| chromosome partitioning protein ParA [Leuconostoc gasicomitatum LMG
           18811]
 gi|299888312|emb|CBL92280.1| Chromosome partitioning protein parA [Leuconostoc gasicomitatum LMG
           18811]
          Length = 253

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 184/252 (73%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT++NL  ALA  G+ VLL+D+D QGNA++G G++  +    SY
Sbjct: 2   AQIIALANQKGGVGKTTTSVNLGAALAQAGKRVLLVDIDAQGNATSGSGVDKSELARDSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++++   I ++++ T   N  ++P+T+ L G E+ L G++ R +RL KALS ++  D+ 
Sbjct: 62  DVMVDLVPIREVIVPT--DNYDLVPATIQLSGAEIELAGQEKREYRLKKALS-EVNDDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  LLT+NA  A+D+IL+P+Q EF+ALEGL QLL T+E VR+  N+ LDI G
Sbjct: 119 FILIDNPPALGLLTVNAFTASDAILIPVQTEFYALEGLGQLLNTIELVRQQFNADLDISG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR   G KVY TVIPR+VR+SEAPSYG+  I +D +  GS+
Sbjct: 179 ILLTMYDGRTNLAKQVSEEVRNYFGDKVYTTVIPRSVRLSEAPSYGQAIIDFDPRSIGSK 238

Query: 246 AYLKLASELIQQ 257
            Y +LA E+++Q
Sbjct: 239 VYSELAQEVLKQ 250


>gi|260588831|ref|ZP_05854744.1| sporulation initiation inhibitor protein Soj [Blautia hansenii DSM
           20583]
 gi|260540610|gb|EEX21179.1| sporulation initiation inhibitor protein Soj [Blautia hansenii DSM
           20583]
          Length = 256

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 178/245 (72%), Gaps = 1/245 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGK+TTAINLS  LA + + VLLID+DPQGN ++G+G++  + + + Y+
Sbjct: 3   RIIAIANQKGGVGKSTTAINLSACLAELNQKVLLIDIDPQGNTTSGVGVDKDNAEATLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E  +   +I+  I NLS+IPS M+L G E+ L   + R + L   +   +  ++ +
Sbjct: 63  LLVGECELKDCIIENVIENLSLIPSNMNLAGAEIELVSVEGREYLLKNHIDT-VKDEYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM  A+S+LVP+QCE++ALEGL+QL+ T+E V+  +N  L I+G+
Sbjct: 122 IIMDCPPSLNILTINAMTTANSVLVPIQCEYYALEGLTQLIHTIELVQERLNPELIIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRNVR++EAPSYG P  +YD K  G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLHQSIYKTIIPRNVRLAEAPSYGIPINLYDTKSVGAES 241

Query: 247 YLKLA 251
           Y  LA
Sbjct: 242 YRLLA 246


>gi|256827810|ref|YP_003151769.1| chromosome segregation ATPase [Cryptobacterium curtum DSM 15641]
 gi|256583953|gb|ACU95087.1| chromosome segregation ATPase [Cryptobacterium curtum DSM 15641]
          Length = 294

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           +++II I NQKGGVGK+TTAINLS AL A G+ VLL+DLDPQGNA++GLGI+     Y  
Sbjct: 42  ETKIIAIINQKGGVGKSTTAINLSAALGASGKAVLLVDLDPQGNATSGLGIDKGQISYDI 101

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           YD+L+ + +++  ++      L ++P+T++L G E+ L  E  R  RL  A+   L   +
Sbjct: 102 YDVLLSDASVDTAIVADVCEGLDVLPATINLAGAEVELVNEMARENRLKSAIG-SLRGKY 160

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LL++++ V+  +N +LDI 
Sbjct: 161 DYILIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLDSMKRVKSMLNPSLDIY 220

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D R +LS+QV  +VR+     V+ T+IPR V++SEAPSYG+P   YD    G 
Sbjct: 221 GVLLTMYDGRTTLSKQVAEEVRRYFDKTVFTTMIPRTVKLSEAPSYGQPITEYDPLGKGG 280

Query: 245 QAYLKLASELIQQ 257
           QAYL LA E+I +
Sbjct: 281 QAYLSLAKEVIAR 293


>gi|187932908|ref|YP_001887730.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           B str. Eklund 17B]
 gi|188588293|ref|YP_001922713.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           E3 str. Alaska E43]
 gi|251778776|ref|ZP_04821696.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
 gi|187721061|gb|ACD22282.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           B str. Eklund 17B]
 gi|188498574|gb|ACD51710.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           E3 str. Alaska E43]
 gi|243083091|gb|EES48981.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           E1 str. 'BoNT E Beluga']
          Length = 254

 Score =  255 bits (651), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 183/254 (72%), Gaps = 2/254 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II + NQKGGVGKTTT INL   LA  G  VL ID+DPQGN ++GLG++  +   S YD
Sbjct: 2   KIICVFNQKGGVGKTTTNINLCGYLAMAGHRVLTIDIDPQGNTTSGLGLDKRNLNVSMYD 61

Query: 67  LLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L  +  I + +++T  + NL I PSTM+L G E+ + G+++R   +   L  ++ S++ 
Sbjct: 62  VLTTDIPIKESILRTDLVENLFIAPSTMELAGAEIEVIGKENRENIMKNKLK-EIESEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+NA+  ADS+L+P+QCEF+ALEG+SQL+ T++ V++++N  L+I+G
Sbjct: 121 YVLIDCPPSLGLLTINALTCADSVLIPIQCEFYALEGVSQLVNTIQLVKKSLNKDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +I+TM+D R +LS +V S+V+K    KVY T IPRN+R++EAPS+G P ++YD KC G++
Sbjct: 181 VIMTMYDYRTNLSNEVFSEVKKYFKSKVYETTIPRNIRLAEAPSFGLPIMLYDDKCKGAE 240

Query: 246 AYLKLASELIQQER 259
           AY+KL  E + ++ 
Sbjct: 241 AYVKLTKEFLSKQE 254


>gi|312897453|ref|ZP_07756877.1| sporulation initiation inhibitor protein Soj [Megasphaera
           micronuciformis F0359]
 gi|310621514|gb|EFQ05050.1| sporulation initiation inhibitor protein Soj [Megasphaera
           micronuciformis F0359]
          Length = 261

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 175/255 (68%), Gaps = 3/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII + NQKGGVGKTTTA+N+S  LA  G+  L+IDLDPQGNA++GLG++       +Y
Sbjct: 5   ARIIAVTNQKGGVGKTTTAVNVSACLAEAGKKSLIIDLDPQGNATSGLGVDKTTLDGGTY 64

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT---S 122
           D LI  + +N I++ T I  L + P+TMDL G  + L   ++R + L KAL   +T    
Sbjct: 65  DALIGNRTMNDIIVSTDIKRLFVAPATMDLAGATVELVNLEEREYILQKALQGVVTPKGK 124

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           DF YI +DCPPS +LLT+NA+ AAD +L+P+QCEF+ALEGL+QL ET+  +   +N  L 
Sbjct: 125 DFDYIIIDCPPSLDLLTVNALVAADFVLIPVQCEFYALEGLAQLTETIRRISADMNRRLS 184

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           + G++LTM+D R +LS QV  +VRK    +V+NT+IPRNVR+ EAPS+G+P   Y     
Sbjct: 185 VLGLLLTMYDGRTNLSLQVADEVRKYFKDRVFNTIIPRNVRLGEAPSFGEPITTYAPSSK 244

Query: 243 GSQAYLKLASELIQQ 257
           G+  Y KLA E+I++
Sbjct: 245 GAAVYKKLAREVIRR 259


>gi|257871374|ref|ZP_05651027.1| cobyrinic acid a,c-diamide synthase [Enterococcus gallinarum EG2]
 gi|257805538|gb|EEV34360.1| cobyrinic acid a,c-diamide synthase [Enterococcus gallinarum EG2]
          Length = 254

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 124/254 (48%), Positives = 179/254 (70%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA +G+ VLL+D+D QGNA++G+GI   D     Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGACLAYVGKKVLLVDIDAQGNATSGVGIRKPDVDKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  I + ++ ++  NL I+P+T+ L G E+ L     R  RL  AL+ ++   + 
Sbjct: 62  DVLVNETPIVEAILPSSRENLDIVPATIQLAGAEIELTSMMARESRLKSALN-EIKDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L+I+G
Sbjct: 121 YIFIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VR+    KVY T+IPRNVR+SEAPS+G   I YD +  G++
Sbjct: 181 VLLTMYDARTNLGAEVVEEVRRYFQEKVYETIIPRNVRLSEAPSHGLSIIDYDPRSKGAE 240

Query: 246 AYLKLASELIQQER 259
            Y  LA E++ +E+
Sbjct: 241 VYQTLAKEVLTREK 254


>gi|227509065|ref|ZP_03939114.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
 gi|227191452|gb|EEI71519.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus brevis subsp. gravesensis ATCC 27305]
          Length = 255

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 175/250 (70%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S +I +ANQKGGVGKTTTA+NL   LA++G+ +LL+D D QGNA++G+GI   D     Y
Sbjct: 2   SYVIALANQKGGVGKTTTAVNLGAGLASLGKKILLVDADAQGNATSGVGISKADIGKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+++ + ++ TA   L I+P+T+ L G E+ L  +  R  RL  AL   +   + 
Sbjct: 62  DVLVNEESMQEAIVHTAHEGLDIVPATIQLSGAEIELTPQMARETRLKAALD-DVRDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  L+T+NA  A+DSIL+P+Q E++ALEGLSQLL T++ VR+  N  L I+G
Sbjct: 121 YVLIDCPPSLGLITINAFTASDSILIPVQSEYYALEGLSQLLNTIQLVRKHFNPDLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L  QV  +VRK    +VY TVIPRNVR+SEAPSYG P + YD K  G+ 
Sbjct: 181 VLLTMFDARTNLGVQVNQEVRKYFKNEVYETVIPRNVRLSEAPSYGLPIMDYDPKSKGAD 240

Query: 246 AYLKLASELI 255
            Y+KLA E++
Sbjct: 241 KYMKLAKEVL 250


>gi|257866241|ref|ZP_05645894.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC30]
 gi|257873245|ref|ZP_05652898.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC10]
 gi|257875876|ref|ZP_05655529.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC20]
 gi|325567659|ref|ZP_08144326.1| sporulation initiation inhibitor protein Soj [Enterococcus
           casseliflavus ATCC 12755]
 gi|257800199|gb|EEV29227.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC30]
 gi|257807409|gb|EEV36231.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC10]
 gi|257810042|gb|EEV38862.1| cobyrinic acid a,c-diamide synthase [Enterococcus casseliflavus
           EC20]
 gi|325159092|gb|EGC71238.1| sporulation initiation inhibitor protein Soj [Enterococcus
           casseliflavus ATCC 12755]
          Length = 254

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 180/253 (71%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL  +LA +G+ VLL+D+D QGNA++G+GI   D +   Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGASLAFVGKKVLLVDIDAQGNATSGVGIRKPDVEQDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  I + ++ ++  NL I+P+T+ L G E+ L     R  RL  AL+ ++   + 
Sbjct: 62  DVLVNETPIVEAILPSSRENLDIVPATIQLAGAEIELTSMMARESRLKSALN-EIKEQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L+I+G
Sbjct: 121 YIFIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R +L  +VV +VR+    KVY T+IPRN+R+SEAPS+G   I YD +  G++
Sbjct: 181 VLLTMYDARTNLGAEVVEEVRRYFQEKVYETIIPRNIRLSEAPSHGLSIIDYDPRSKGAE 240

Query: 246 AYLKLASELIQQE 258
            Y  LA E++ +E
Sbjct: 241 VYQTLAKEVLARE 253


>gi|299135913|ref|ZP_07029097.1| Cobyrinic acid ac-diamide synthase [Acidobacterium sp. MP5ACTX8]
 gi|298602037|gb|EFI58191.1| Cobyrinic acid ac-diamide synthase [Acidobacterium sp. MP5ACTX8]
          Length = 299

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 182/256 (71%), Gaps = 1/256 (0%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           E+K +++I I NQKGGVGKTTTAINL+ + A  G   LLID DPQ N + GLG+   D +
Sbjct: 13  EKKLTKVIAIVNQKGGVGKTTTAINLAASFALEGVRTLLIDCDPQANTTGGLGLPRDDER 72

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            S YD+L+ E      ++ T + NLS+IP T +++G  + L   + R FRL  AL   + 
Sbjct: 73  ASIYDVLVGETEAKDAILPTELENLSLIPGTKNMIGANLELVSAERREFRLRDALE-PIR 131

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           SD+++I LDCPP+ +LLT+NA+ A+D +LVP+Q E+FALEG+S+L+ T++ V    NS L
Sbjct: 132 SDYTFILLDCPPALDLLTLNALVASDGLLVPMQAEYFALEGISELMSTLDRVADAFNSGL 191

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            ++G++LTMFD R +LSQQV +++++    K+Y T IPRN+R++EAPS+GKPA+ YD + 
Sbjct: 192 ALEGVLLTMFDDRTNLSQQVHNNLKEFFTDKLYTTFIPRNIRLAEAPSHGKPAVTYDPRS 251

Query: 242 AGSQAYLKLASELIQQ 257
            G++AY +LA E++++
Sbjct: 252 RGAEAYRELALEVLKR 267


>gi|91214655|ref|ZP_01251628.1| putative ParA chromosome partitioning protein [Psychroflexus
           torquis ATCC 700755]
 gi|91187082|gb|EAS73452.1| putative ParA chromosome partitioning protein [Psychroflexus
           torquis ATCC 700755]
          Length = 254

 Score =  254 bits (650), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+IANQKGGVGKTTTA+NL+ AL  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIISIANQKGGVGKTTTAVNLAAALGVLEKKVLLIDADPQANATSGLGIDIETVEIGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L   K   + ++ T  PNL +IPS +DL+ IE+ L   + R + L +AL + + S F Y
Sbjct: 63  ILEHTKKAEEAIMDTDSPNLELIPSHIDLVAIELELVDVERREYMLKEAL-LPIKSKFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+L+P+QCE+FALEGL +LL T++ V++  N  L I+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVLIPIQCEYFALEGLGKLLNTIKSVQKIHNDQLSIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVKKHFNDMVFETIIQRNVRLSEAPSYGESIIKYDATSKGASN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAEEIIKK 252


>gi|332143482|ref|YP_004429220.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553504|gb|AEB00223.1| transcriptional regulator of chromosome partitioning protein; ParA
           family protein; could be a protein tyrosine kinase
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 264

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I IANQKGGVGKTTTA+N++ ++AA    VLLIDLDPQGNA+ G G++ YD + +++
Sbjct: 2   AKVIAIANQKGGVGKTTTAVNVAASMAATKRKVLLIDLDPQGNATMGSGVDKYDVESTAF 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LLIEEK I+ ++++       +I +  D+   E+ L     R  RL  AL   +   + 
Sbjct: 62  ELLIEEKPIDDVIVKGTSGKYDLIAANGDVTAAEIKLMEMFAREVRLRNALK-PVMDYYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++F+DCPPS N LT+NA+AAADS++VP+QCE++ALEGL+ L++T++++   VN  L I+G
Sbjct: 121 FVFIDCPPSLNQLTVNALAAADSVMVPMQCEYYALEGLTALMDTIQKLASVVNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D RN L+  V   ++++ G +VY TVIPRNVR++EAPS+G PA+ YD    G++
Sbjct: 181 VLRTMYDPRNRLANDVSEQLKRHFGEQVYRTVIPRNVRLAEAPSFGTPAMYYDKSSTGAK 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E++++
Sbjct: 241 AYLALAGEILRR 252


>gi|198284888|ref|YP_002221209.1| cobyrinic acid ac-diamide synthase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666261|ref|YP_002427568.1| chromosome partitioning protein parA [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198249409|gb|ACH85002.1| Cobyrinic acid ac-diamide synthase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518474|gb|ACK79060.1| chromosome partitioning protein parA [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 260

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 177/252 (70%), Gaps = 3/252 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R + IANQKGGVGKTTTA+NL+  LA  G+ VLLIDLDPQ NA+TGLG+       + Y 
Sbjct: 9   RTVAIANQKGGVGKTTTAVNLAAGLAQNGKRVLLIDLDPQANATTGLGLG-GSATATIYH 67

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L+ E  ++ +L+      LS+ PS+ DL G E+ L G  DR  RL  AL+    + F Y
Sbjct: 68  ALLGELPLSAVLLNAFPEGLSLAPSSPDLAGAEVELYGRPDRERRLQDALAP--VAGFDY 125

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
             +DCPP+ N+LT+NA+ AADS+L+P+QCE++ALEGL+QLL TV  VR  +N  L++ G+
Sbjct: 126 ALIDCPPALNMLTINALVAADSVLIPMQCEYYALEGLTQLLGTVRRVRAQLNPRLEVHGL 185

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD+RN L+ +V  ++ ++   K+Y  V+PRN+R++EAPS+G+ A++YD  CAGS+A
Sbjct: 186 LRTMFDNRNRLASEVALELERHFPDKLYQAVVPRNIRLAEAPSFGRAALVYDPACAGSRA 245

Query: 247 YLKLASELIQQE 258
           Y  +A+E +++E
Sbjct: 246 YQGVATEFLRRE 257


>gi|288939801|ref|YP_003442041.1| cobyrinic acid ac-diamide synthase [Allochromatium vinosum DSM 180]
 gi|288895173|gb|ADC61009.1| Cobyrinic acid ac-diamide synthase [Allochromatium vinosum DSM 180]
          Length = 264

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 182/259 (70%), Gaps = 3/259 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           II IANQKGGVGKTTTA+NL+ ALA +   VLLIDLDPQGNA+ G G++ +  ++++ DL
Sbjct: 4   IIAIANQKGGVGKTTTAVNLAAALAFMRRRVLLIDLDPQGNATMGCGVDKHQVEHTTCDL 63

Query: 68  LIEEKNINQIL--IQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           L+ E  I   L  +    P   ++PS  DL   E+ L    DR  RL K L+  + + + 
Sbjct: 64  LLTEVPIADCLQRVTEPAPGFDLLPSNADLTAAEIGLLDSPDREQRLSKVLATAVGA-YE 122

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
            + +DCPPS N+LT+NA+ AA  +L+P+QCE++ALEGLS LL+T+E+VR + N+ L I+G
Sbjct: 123 MVIIDCPPSLNMLTLNALVAAHGVLIPIQCEYYALEGLSSLLDTIEQVRESRNAGLRIEG 182

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM D RN+L+ QV + +  +   +VY T+IPRNVR++EAPS+G+ A++YD +  G+ 
Sbjct: 183 ILRTMHDPRNNLANQVSTQLVTHFKDQVYRTIIPRNVRVAEAPSHGQSALVYDPQSRGAL 242

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LASE+++++  R++A
Sbjct: 243 AYLALASEVLRRQEKRRQA 261


>gi|187777376|ref|ZP_02993849.1| hypothetical protein CLOSPO_00932 [Clostridium sporogenes ATCC
           15579]
 gi|187774304|gb|EDU38106.1| hypothetical protein CLOSPO_00932 [Clostridium sporogenes ATCC
           15579]
          Length = 254

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 186/254 (73%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S YD
Sbjct: 2   KVISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYD 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I +++ Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIREVIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLEKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+DS+L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDSKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|157273384|gb|ABV27283.1| SpoOJ regulator protein [Candidatus Chloracidobacterium
           thermophilum]
          Length = 279

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 123/255 (48%), Positives = 179/255 (70%), Gaps = 1/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTTAINL+ +LA      LL+D DPQ NAS+G+GI     + + Y 
Sbjct: 15  KIIAVANQKGGVGKTTTAINLAASLAVNDRQTLLVDADPQANASSGVGIRRGTLRRTLYH 74

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI ++ ++ I+  T +P L + P+  +L G E+ L   ++R F + + L       + Y
Sbjct: 75  ALILDEPLSNIIQMTELPGLQVAPADRNLAGAEVELVNLEEREFVMRRVLG-GYRQRYDY 133

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA++AADS+LVP+QCE+FALEG+S+LL+T+  +RR++N  L I+G 
Sbjct: 134 IIIDCPPSLGLLTINALSAADSVLVPIQCEYFALEGVSELLDTLTRIRRSLNPTLAIEGF 193

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV +D+R   G +V+ TVI RN+R++EAPS+GKP I+YD+K  G+ A
Sbjct: 194 LLTMFDERTNLSNQVAADLRDFYGKQVFETVITRNIRLAEAPSHGKPIILYDIKSRGANA 253

Query: 247 YLKLASELIQQERHR 261
           YL+LA E+I  +  +
Sbjct: 254 YLQLAKEVISHDNQK 268


>gi|220903303|ref|YP_002478615.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219867602|gb|ACL47937.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 262

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/257 (47%), Positives = 183/257 (71%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII+IANQKGGVGKTTTAINLS ALA + + VLL+D DPQ N+++GLG++  +     Y
Sbjct: 2   ARIISIANQKGGVGKTTTAINLSAALAVMEKKVLLVDCDPQANSTSGLGLQQENLHGDLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +   E + + Q + ++  P L I+P++ +L+ +E+ L  +  R F LD+ L   +  D+ 
Sbjct: 62  NTFYEPEQVRQNIAKSRSPFLDILPASTNLVAVELELVDKMAREFYLDECLKA-VQKDYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  LLT+NA+ A+  +L+PLQCEFFALEG+ +LL+T E+V++ +N  L + G
Sbjct: 121 YIILDCPPSLGLLTLNALCASRELLIPLQCEFFALEGIVKLLQTYEQVKKRLNPELSLLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+RN L+++V ++VR+     ++ TVIPRNVR+SEAPS+GK  I YD+K  G+ 
Sbjct: 181 VVLTMYDTRNRLTREVKNEVRRCFPDHLFETVIPRNVRLSEAPSHGKSIIHYDIKSKGAD 240

Query: 246 AYLKLASELIQQERHRK 262
           AYL L+ E++ +   +K
Sbjct: 241 AYLGLSKEVVLRRPSKK 257


>gi|149375655|ref|ZP_01893424.1| ParA family protein [Marinobacter algicola DG893]
 gi|149360057|gb|EDM48512.1| ParA family protein [Marinobacter algicola DG893]
          Length = 264

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 180/260 (69%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I + NQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G G++    + S Y
Sbjct: 2   ARVIAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGVDKNALELSGY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L +     +++ +  +    I+P+  DL   E+ L  E  R  RL  AL+ ++  ++ 
Sbjct: 62  DMLTKRAAAAEVIFRADVSGFDILPANGDLTAAEVELMNEIGREHRLRLALN-KVRENYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NA++AAD++L+P+QCE++ALEGL+ L+ TVE+++ TVN  L ++G
Sbjct: 121 YILIDCPPSLSLLTVNALSAADTVLIPMQCEYYALEGLAALMNTVEQIQETVNPDLQVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+  V S + +  G KVY  VIPRNVR++EAPSYG PA+ YD    G+ 
Sbjct: 181 ILRTMYDPRNSLTLDVSSQLNEFFGDKVYRAVIPRNVRLAEAPSYGMPALKYDRASKGAV 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E++++   +K +A
Sbjct: 241 AYLALAGEMVRRHGSQKTSA 260


>gi|331083506|ref|ZP_08332618.1| hypothetical protein HMPREF0992_01542 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330404199|gb|EGG83747.1| hypothetical protein HMPREF0992_01542 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 256

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 177/245 (72%), Gaps = 1/245 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGK+TTAINLS  LA + + VLLID+DPQGN ++G+G++  + + + Y+
Sbjct: 3   RIIAIANQKGGVGKSTTAINLSACLAELNQKVLLIDIDPQGNTTSGVGVDKDNAEATLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E  +   +I+  I NLS+IPS M+L G E+ L   + R + L   +   +   + +
Sbjct: 63  LLVGECELKDCIIENVIENLSLIPSNMNLAGAEIELVSVEGREYLLKNHIDT-VKDKYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM  A+S+LVP+QCE++ALEGL+QL+ T+E V+  +N  L I+G+
Sbjct: 122 IIMDCPPSLNILTINAMTTANSVLVPIQCEYYALEGLTQLIHTIELVQERLNPELIIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NL   +Y T+IPRNVR++EAPSYG P  +YD K  G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLHQSIYKTIIPRNVRLAEAPSYGIPINLYDTKSVGAES 241

Query: 247 YLKLA 251
           Y  LA
Sbjct: 242 YRLLA 246


>gi|20809120|ref|NP_624291.1| ATPase involved in chromosome partitioning [Thermoanaerobacter
           tengcongensis MB4]
 gi|254479401|ref|ZP_05092734.1| putative CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [Carboxydibrachium pacificum DSM 12653]
 gi|20517799|gb|AAM25895.1| ATPases involved in chromosome partitioning [Thermoanaerobacter
           tengcongensis MB4]
 gi|214034670|gb|EEB75411.1| putative CobQ/CobB/MinD/ParA nucleotide binding domain protein
           [Carboxydibrachium pacificum DSM 12653]
          Length = 255

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 179/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL  ALA  G+ VL ID+DPQ N ++G G+      +++Y 
Sbjct: 3   KVIAVANQKGGVGKTTTVVNLGYALAVKGKKVLCIDIDPQSNMTSGFGVNPASLDHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI+E+ I   +++     L I+PS++ L G E+ L     R +RL KA+   +   + Y
Sbjct: 63  VLIDEEEIENAILKLEQYGLDIVPSSIQLAGAEIELVPMISREYRLKKAIE-SVKEKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N +L+I+G+
Sbjct: 122 ILIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPSLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPSYGKP  +YD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKEKVYRTIIPRNIRLGEAPSYGKPISLYDPTSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y  LA E+I++
Sbjct: 242 YEDLAEEVIER 252


>gi|260893976|ref|YP_003240073.1| Cobyrinic acid ac-diamide synthase [Ammonifex degensii KC4]
 gi|260866117|gb|ACX53223.1| Cobyrinic acid ac-diamide synthase [Ammonifex degensii KC4]
          Length = 254

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 178/251 (70%), Gaps = 2/251 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +++ +ANQKGGV KTTT +NL   LA +G+ VL++D DPQ NA++GLG+       + Y
Sbjct: 2   GKVVAVANQKGGVAKTTTVVNLGACLALLGKRVLVVDTDPQANATSGLGLNPAKLSRTLY 61

Query: 66  DLLIEEKNINQI-LIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
            +L+ E +   + L   ++P L +IP++++L G E+ L G  +R   L +AL   L S +
Sbjct: 62  QVLLGEVSAEAVKLPCPSVPGLEVIPASIELAGAEVELVGVAERESLLRRALG-PLRSRY 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  +LT+NA+ AAD +L+P+QCE++ALEGL  LL T++ V+R +N  L+I+
Sbjct: 121 DYLFIDCPPSLGILTLNALVAADGVLIPIQCEYYALEGLGHLLNTIQLVKRRLNPRLEIE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFD R +LS QV  +V+K+  GKVY T+IPRNVR+SEAPS+GKP  IYD +  G+
Sbjct: 181 GVLLTMFDGRTNLSIQVAEEVKKHFRGKVYRTIIPRNVRLSEAPSHGKPVAIYDPRSRGA 240

Query: 245 QAYLKLASELI 255
           +AY +LA E++
Sbjct: 241 EAYFELAREVM 251


>gi|83649683|ref|YP_438118.1| ParA family protein [Hahella chejuensis KCTC 2396]
 gi|83637726|gb|ABC33693.1| ParA family protein [Hahella chejuensis KCTC 2396]
          Length = 263

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 181/260 (69%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ + NQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G GI+    +++ Y
Sbjct: 2   ARILAVTNQKGGVGKTTTCVNLAASLAATRRKVLLVDIDPQGNATMGSGIDKNSIEHTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L ++ N  Q++  +      ++P+  D+   E+ L  E  R +RL  A+  ++  ++ 
Sbjct: 62  DVLTKKANAAQVVKTSEAAGYDVMPANGDVTAAEVELMNEIGREYRLRNAIK-EVAVNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ LDCPP+ NLLT+NA+ AA+ +L+P+QCE++ALEGL+ L+ T+E++R TVN +L+I+G
Sbjct: 121 YVLLDCPPALNLLTVNALVAANGVLIPMQCEYYALEGLAALMNTIEQIRETVNPSLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D RNSL+  V   +    G KVY ++IPRNVR++EAPSYG PA+ YD    G+ 
Sbjct: 181 LLRTMYDPRNSLTLDVSRQITDYFGEKVYRSIIPRNVRLAEAPSYGVPALKYDKSSRGAI 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E+I+++R   + A
Sbjct: 241 AYLALAGEIIRKDRKAAKEA 260


>gi|88860627|ref|ZP_01135264.1| transcriptional regulator of chromosome partitioning protein
           [Pseudoalteromonas tunicata D2]
 gi|88817222|gb|EAR27040.1| transcriptional regulator of chromosome partitioning protein
           [Pseudoalteromonas tunicata D2]
          Length = 261

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I IANQKGGVGKTTTA+NL+ ++AA    VLL+DLDPQGNA+ G G++ Y    + Y
Sbjct: 2   AKVIAIANQKGGVGKTTTAVNLAASMAATKRKVLLVDLDPQGNATMGSGVDKYADIATVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+EEK  ++++         +I +  D+   E+ L     R  RL  AL + +   + 
Sbjct: 62  DLLVEEKPFDEVVQTETSGEYHLIAANGDVTAAEVKLMELFAREVRLRNALDL-IRDRYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS N+LT+NAMAAADS+LVP+QCE++ALEGL+ L++T+ ++ + VN  L I+G
Sbjct: 121 FIIIDCPPSLNMLTVNAMAAADSVLVPMQCEYYALEGLTALMDTITQLAKLVNPKLQIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNRLANDVSEQLKQHFGEKVYRTVIPRNVRLAEAPSFGTPAMYYDRSSSGAK 240

Query: 246 AYLKLASELIQQE 258
           AYL LA E+++++
Sbjct: 241 AYLALAGEMLRRK 253


>gi|326804287|ref|YP_004322105.1| sporulation initiation inhibitor protein Soj [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651219|gb|AEA01402.1| sporulation initiation inhibitor protein Soj [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 254

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 181/253 (71%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTA+NL+ ALA   + VLL+D D QGNA++GLGI   + +   YD
Sbjct: 3   KVIAIANQKGGVGKTTTAVNLAAALAYSDKQVLLVDSDAQGNATSGLGISKAEVERDIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ + ++   + Q++  NL ++P+T+ L G E+ L     R  R+ +A+   +  ++ Y
Sbjct: 63  VLVNDVDMATTIQQSSRENLVLVPATIQLAGAEVELTNLPHREARMKQAID-GVKENYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS   LT+NA  AAD+IL+P+Q E++ALEGLSQLL T++ V++  N  L I+G+
Sbjct: 122 VIIDCPPSLGHLTINAFTAADAILIPVQSEYYALEGLSQLLNTIQLVQKHFNPHLKIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TMFDSR +L+ +VV +VRK  G KVYNT+IPRNVR+SEAPSYG+  I YD+   G+Q 
Sbjct: 182 LMTMFDSRTNLANEVVEEVRKYFGDKVYNTLIPRNVRLSEAPSYGQSIIDYDMSSKGAQV 241

Query: 247 YLKLASELIQQER 259
           YL+LA E++  ++
Sbjct: 242 YLQLAKEVLANDQ 254


>gi|86131723|ref|ZP_01050320.1| ATPase, ParA family [Dokdonia donghaensis MED134]
 gi|85817545|gb|EAQ38719.1| ATPase, ParA family [Dokdonia donghaensis MED134]
          Length = 255

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESVEVGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL         +++T+ PNL +IP+ +DL+ IE+ L  ++ R + L KA+S  L   + Y
Sbjct: 63  LLEHTNKAEDAIVKTSSPNLDLIPAHIDLVAIEIELVDKEAREYMLKKAIS-HLKDVYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ +ADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTSADSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNKDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V+K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVEEVQKHFSEMVFETIIQRNVRLSEAPSYGESIINYDAASKGATN 241

Query: 247 YLKLASELIQQ 257
           YL LA ELI +
Sbjct: 242 YLSLAQELITK 252


>gi|15639264|ref|NP_218713.1| SpoOJ regulator (soj) [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189025506|ref|YP_001933278.1| chromosome partitioning protein [Treponema pallidum subsp. pallidum
           SS14]
 gi|12230549|sp|O83296|SOJ_TREPA RecName: Full=Protein soj homolog
 gi|3322545|gb|AAC65260.1| SpoOJ regulator (soj) [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189018081|gb|ACD70699.1| chromosome partitioning protein [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059675|gb|ADD72410.1| sporulation initiation inhibitor protein Soj [Treponema pallidum
           subsp. pallidum str. Chicago]
          Length = 253

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 176/256 (68%), Gaps = 4/256 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            + +   NQKGGVGKTT+AINL   LA  G+  LL+D DPQGN S+GLG+    R  + Y
Sbjct: 2   GKTLVFVNQKGGVGKTTSAINLGAYLALAGKKTLLVDFDPQGNMSSGLGLA---RGLTVY 58

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL  + +IN +L  T + NL  IP+++DL G  + L  E+DR   L K L+ ++   + 
Sbjct: 59  DLLAGKAHINSVLRTTPVHNLFAIPASIDLSGATVELVDEQDRELYLKKILA-EVKDTYD 117

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  +LT+N +AAA+ + +PLQCE+FALEGL+ LL+TV+ V+  +N+AL I G
Sbjct: 118 FILIDCPPSLGILTLNGLAAANEVFIPLQCEYFALEGLTLLLQTVKRVQSGLNTALSIGG 177

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I  TM+D+R  L+Q+VV  V    G KV+NT+IPRNV++SEAPS+G P   YD +CAG++
Sbjct: 178 IFFTMYDTRTKLAQEVVKQVTTYFGDKVFNTIIPRNVKLSEAPSHGLPISSYDAQCAGAR 237

Query: 246 AYLKLASELIQQERHR 261
           +Y KLA E++ ++  R
Sbjct: 238 SYEKLAREIVARDGQR 253


>gi|331086944|ref|ZP_08336020.1| hypothetical protein HMPREF0987_02323 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330409605|gb|EGG89044.1| hypothetical protein HMPREF0987_02323 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 255

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 114/251 (45%), Positives = 186/251 (74%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII +ANQKGGVGKTTTAINLS+ L+A+G+ VL ID+DPQGN ++GLG++  + + + YD
Sbjct: 3   RIIAVANQKGGVGKTTTAINLSSCLSALGKRVLAIDMDPQGNMTSGLGVDKDNVEKTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I    + + L +    NL ++P+ +DL   E+ L G +++ F +   ++ ++  ++ +
Sbjct: 63  LIIGRATVEECLCKEVFENLDLLPTNIDLSAAEIELIGVENKEFIIRDEVA-KIRGNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS ++LT+NAM  AD++LVP+QCE++ALEGLSQL+ T++ V+  +N  L+++G+
Sbjct: 122 VIVDCPPSLSMLTINAMTTADTVLVPIQCEYYALEGLSQLMHTIDLVKERLNPDLEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+++R +LS QVV +V+ NL   +Y T+IPRN+R++EAPS+G P  IYD K +G+++
Sbjct: 182 VFTMYNARTNLSLQVVENVKDNLDQTIYKTIIPRNIRLAEAPSHGLPINIYDPKSSGAES 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I +
Sbjct: 242 YMLLAEEVIHK 252


>gi|302388588|ref|YP_003824410.1| chromosome partitioning protein [Clostridium saccharolyticum WM1]
 gi|302199216|gb|ADL06787.1| chromosome partitioning protein [Clostridium saccharolyticum WM1]
          Length = 256

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS  LA   + VL +D DPQGN ++GLGIE    + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTAINLSACLAESRQRVLAVDFDPQGNETSGLGIEKSSIERTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E  I + LI     NL ++PS +DL G E+ L   +++   L   L  ++   + +
Sbjct: 63  LLVGECEIEECLITNVQENLDLLPSNVDLAGAEIELLEIENKETLLKTYLE-KIKKHYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS NLLT+NA+ AA+++LVP+QCE++ALEGLSQ+L+TV  V++ +N AL+++G+
Sbjct: 122 IIIDCPPSLNLLTINALTAANTVLVPIQCEYYALEGLSQVLKTVNLVKKKLNPALEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV  V+ NL   +Y T+IPRNVR++EAPS+G P  +YD + AG+++
Sbjct: 182 VFTMYDARTNLSLEVVESVKNNLNQNIYKTIIPRNVRLAEAPSHGMPINLYDSRSAGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA+E+I +
Sbjct: 242 YRLLAAEVISR 252


>gi|309390341|gb|ADO78221.1| chromosome segregation ATPase [Halanaerobium praevalens DSM 2228]
          Length = 253

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 181/250 (72%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++ I I NQKGGVGK+TTA+N S +LA  G  VLLID+DPQGNAS+GLGI   + + + Y
Sbjct: 2   AKKIAIVNQKGGVGKSTTAVNFSASLAEKGNKVLLIDIDPQGNASSGLGINKSEVEDTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLIE +   + +++T   NL +IP+ ++L G E+ L     R  RL+K+L +++   + 
Sbjct: 62  DLLIEAEPAVKAILKTEAQNLDLIPANIELAGAEIELVSLMSRESRLEKSL-IKINPAYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL QL+ T++ VR+ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTLNALTAADSVIVPIQCEYYALEGLGQLMNTIDLVRKNLNPDLRIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TM+D+R +LSQQV+ +V++     V+ TVIPRNVR+SEAPS+G+  + Y  K  G+ 
Sbjct: 181 VLMTMYDARTNLSQQVIDEVKEYFSELVFKTVIPRNVRLSEAPSFGQTILAYSSKSKGAL 240

Query: 246 AYLKLASELI 255
           AY KLA E+I
Sbjct: 241 AYRKLAEEVI 250


>gi|167629162|ref|YP_001679661.1| cobyrinic acid a,c-diamide synthase, putative [Heliobacterium
           modesticaldum Ice1]
 gi|167591902|gb|ABZ83650.1| cobyrinic acid a,c-diamide synthase, putative [Heliobacterium
           modesticaldum Ice1]
          Length = 253

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++I +ANQKGGV KTTTA+N+S  LA +G+NVLL+D+DPQGNA++G GI+    ++  Y
Sbjct: 2   AQVIAVANQKGGVAKTTTAVNVSACLAELGKNVLLVDMDPQGNATSGSGIDKLRVRHCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI       IL +T      ++P+T+ L G E+ L     R  +L +AL   + + F 
Sbjct: 62  DVLINGAPSTSILTKTDWERFFVLPATIQLAGAEIELVSAISREVKLRRALD-PMRNRFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+N++ AAD +L+P+QCE++ALEGL QL+ T++ V++ +NS L I G
Sbjct: 121 YIIIDCPPSLGLLTLNSLTAADQLLIPIQCEYYALEGLGQLMSTIKLVQKHLNSELTILG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L+ QVV +V+ +   KV+ T+IPRNVR+SEAPS+G+P I+YD +  G++
Sbjct: 181 VLLTMFDARTNLAIQVVDEVKNHFHDKVFKTIIPRNVRLSEAPSHGQPIIVYDTRSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y +LA E++++
Sbjct: 241 VYRELAKEVLER 252


>gi|326793311|ref|YP_004311132.1| cobyrinic acid ac-diamide synthase [Clostridium lentocellum DSM
           5427]
 gi|326544075|gb|ADZ85934.1| Cobyrinic acid ac-diamide synthase [Clostridium lentocellum DSM
           5427]
          Length = 254

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 177/253 (69%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II + NQKGGVGKTTT +NL+ AL    + VL++D+DPQGNA++G G+     + + YD
Sbjct: 3   KIIAVVNQKGGVGKTTTVVNLAAALVEKKKKVLIVDIDPQGNATSGCGVLKGQNQATIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ E NI  ++ +    N+ IIPS M+L G E+ L   K R F L K L   ++ ++ Y
Sbjct: 63  VLVNEANIKDVIKKAEHENIYIIPSNMNLAGTEVELVNTKQREFILKKQLET-VSDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPP+ N+LT+NA+ A++S+L+P+QCE++ALEGLSQL++T+  V++  N+ L ++GI
Sbjct: 122 IFIDCPPAVNILTINALTASNSVLIPMQCEYYALEGLSQLVQTIGLVKKNTNNKLVLEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ +    VYNT I R+VR+SEAPS+G   I YD K  GS+ 
Sbjct: 182 LFTMYDNRTNLSSQVVKEVKNHFSSTVYNTKITRSVRLSEAPSFGMSCICYDPKSKGSEQ 241

Query: 247 YLKLASELIQQER 259
           Y  LA E I++ +
Sbjct: 242 YRSLAKEFIERNK 254


>gi|256372781|ref|YP_003110605.1| Cobyrinic acid ac-diamide synthase [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256009365|gb|ACU54932.1| Cobyrinic acid ac-diamide synthase [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 253

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 174/248 (70%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTTA+NL+ ALA  G  VLL+D DPQGNA+TGLG+   D   S YD
Sbjct: 3   RVIAVANQKGGVGKTTTAVNLAAALAEQGARVLLVDFDPQGNATTGLGVNPRDLAGSIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            ++ E  +  ++  T + N+ +  +T+DL G E+ L     R  RL +AL   +  D+ Y
Sbjct: 63  AVVHETPLEDVIEATGVRNVFVAGATIDLAGAEIELVSVLSRETRLRRALE-PVRGDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS  LLT+NA+AAAD +LVP+QCE++ALEGLSQL   V  V++++N  L +  +
Sbjct: 122 IFIDCPPSLGLLTVNALAAADEVLVPIQCEYYALEGLSQLFRNVTLVQQSLNPTLRVSHV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TMFD+R +LS+QVV++V++  G  V  TVIPRN+R+SEAPS+G+P   +D    G+ A
Sbjct: 182 VMTMFDARTNLSEQVVANVKEFCGDLVCETVIPRNIRLSEAPSFGQPITTFDPSSRGAIA 241

Query: 247 YLKLASEL 254
           Y  LA+EL
Sbjct: 242 YRDLATEL 249


>gi|311696579|gb|ADP99452.1| chromosome partitioning protein parA [marine bacterium HP15]
          Length = 264

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 178/260 (68%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I + NQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G G++    + S Y
Sbjct: 2   ARVIAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGVDKNALELSGY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L +  +  +++I        I+P+  DL   E+ L  E  R  RL  AL+  +  ++ 
Sbjct: 62  DMLTKRASAAEVIIPAEASGFDILPANGDLTAAEVELMNEIGREHRLRLALNT-VRDNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NA++AADS+L+P+QCE++ALEGL+ L+ TVE+++ TVN  L ++G
Sbjct: 121 YILIDCPPSLSLLTVNALSAADSVLIPMQCEYYALEGLAALMNTVEQIQETVNPNLQVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+  V   + +  G KVY  VIPRNVR++EAPSYG PA+ YD    G+ 
Sbjct: 181 ILRTMYDPRNSLTLDVSGQLSEYFGDKVYRAVIPRNVRLAEAPSYGVPALKYDRASKGAI 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA E++++   +K +A
Sbjct: 241 AYLALAGEMVRRHGSKKTSA 260


>gi|163791210|ref|ZP_02185627.1| ATPase, ParA family protein [Carnobacterium sp. AT7]
 gi|159873541|gb|EDP67628.1| ATPase, ParA family protein [Carnobacterium sp. AT7]
          Length = 253

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 178/250 (71%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA  G+ +LL+D+D QGNA++GLG+   D +   Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGACLAYFGKKILLVDIDAQGNATSGLGVRKSDVEKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  + ++++ ++  NL ++P+T+ L G E+ L  +  R  RL +AL  ++  D+ 
Sbjct: 62  DILVNETLVTEVVLPSSRENLWVVPATIQLAGAEIELTSQMARESRLKQALE-KVRDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L I+G
Sbjct: 121 YILIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  +VV +V+K    +VY T+IPRN+R+SEAPS+G   I YD +  G++
Sbjct: 181 VLLTMLDARTNLGYEVVDEVKKYFRERVYKTIIPRNIRLSEAPSHGLSIIDYDARSRGAE 240

Query: 246 AYLKLASELI 255
            YL+LA E++
Sbjct: 241 VYLELAKEVL 250


>gi|254455644|ref|ZP_05069073.1| transcriptional regulator of chromosome partitioning protein ParA
           family protein; putative protein tyrosine kinase
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082646|gb|EDZ60072.1| transcriptional regulator of chromosome partitioning protein ParA
           family protein; putative protein tyrosine kinase
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 264

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 177/263 (67%), Gaps = 4/263 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS-Y 65
           +II++ NQKGGVGKTTT INL+  L  + + +L+IDLDPQGNA+TGLG+   D    + Y
Sbjct: 2   QIISVINQKGGVGKTTTVINLAAGLTQLNKKILIIDLDPQGNATTGLGLSNVDNSSDTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD-- 123
            +L   + IN+I+ +T   NL II S +DL G+E+    + +R F L   L+  L +   
Sbjct: 62  GVLNGTRQINEIIKRTQFENLDIITSNVDLSGLEVETADDSNRAFILKAKLTSYLNNSRG 121

Query: 124 -FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + Y+ +DCPPS +LLT+ A+  ++S+LVPLQ EFFALEGL+QL++T+E ++ ++N  L 
Sbjct: 122 LYDYVLIDCPPSLSLLTVMALVCSNSLLVPLQTEFFALEGLTQLMKTIERIKVSLNPDLK 181

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+LTM+D RN LS QV  + R     KVY+TVIPRNVR+SEAPS+G P +IYD  C 
Sbjct: 182 IRGILLTMYDKRNKLSSQVEKEARDYFNEKVYSTVIPRNVRLSEAPSHGVPVLIYDKSCP 241

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GS++Y     E I QE     AA
Sbjct: 242 GSKSYFNFTDEFINQESTIGSAA 264


>gi|332702227|ref|ZP_08422315.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552376|gb|EGJ49420.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 258

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 179/254 (70%), Gaps = 3/254 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS- 64
           +R I IANQKGGVGKTTTA+NL+  LA +   VLL+D DPQ NAS+GLG    DR+  S 
Sbjct: 2   ARQIVIANQKGGVGKTTTAVNLAACLAVMERQVLLVDCDPQANASSGLGY-YQDREGPSL 60

Query: 65  YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           Y +  E     + + +T +P LS++P++ D++G+E+ L  +  R + L + L+  L   +
Sbjct: 61  YHVFFEPAEAEKAIYKTELPYLSLMPASTDMVGLEIELIEKLGREYYLSEVLA-GLRDKY 119

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS  L T+NA+ AA  +L+PLQCE++ALEG++QL+ T   V++ +N  L+I 
Sbjct: 120 DYIIMDCPPSLGLTTVNALCAAKELLIPLQCEYYALEGIAQLMRTYNIVKKRLNPDLEIS 179

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTM+D RN LS QV ++VR++   K++ T++PRNVR+SEAPS+GKP I YD+K  G+
Sbjct: 180 GVVLTMYDKRNRLSGQVKNEVRRSFPDKMFETIVPRNVRLSEAPSFGKPIISYDIKSVGA 239

Query: 245 QAYLKLASELIQQE 258
           QAYL LA EL+ +E
Sbjct: 240 QAYLSLAQELVDKE 253


>gi|261415841|ref|YP_003249524.1| Cobyrinic acid ac-diamide synthase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372297|gb|ACX75042.1| Cobyrinic acid ac-diamide synthase [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326352|gb|ADL25553.1| ATPase, ParA family [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 261

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 125/263 (47%), Positives = 187/263 (71%), Gaps = 12/263 (4%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGI---------E 56
           S+II I NQKGGVGKTTTA+NL+ + AA+ +  LL+D+DPQGNAS GLG          E
Sbjct: 2   SKIIAICNQKGGVGKTTTAVNLAASFAALEKKTLLLDMDPQGNASQGLGFMESQDMDIHE 61

Query: 57  LYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKAL 116
           + D   +  +L +E  NI   ++ T++  L +I S  DL  +E+ L     R  RL++ +
Sbjct: 62  ILDMAGNPDNLTLE--NIKPAILDTSLEYLKVITSGPDLAVMEIELVNAMSRERRLERVM 119

Query: 117 SVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
           +V L  +F +I +D PPS NLLT+N + AA S+L+P+QCE++AL+G+++L +T+ EV++ 
Sbjct: 120 NV-LKQEFDFIIIDAPPSLNLLTINTLTAATSVLIPVQCEYYALQGMTELFKTIREVQKN 178

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +NS L I+G +LTM+DSR SLS+QV  +VR+NL   V+ T+IPRNV++SEAPS+GKP I+
Sbjct: 179 LNSNLKIEGALLTMYDSRLSLSKQVAEEVRENLSDTVFQTMIPRNVKLSEAPSHGKPVIL 238

Query: 237 YDLKCAGSQAYLKLASELIQQER 259
           YD++  GSQ+Y+KLA E++ +E+
Sbjct: 239 YDVQSTGSQSYMKLAEEILNKEK 261


>gi|325291444|ref|YP_004267625.1| chromosome segregation ATPase [Syntrophobotulus glycolicus DSM
           8271]
 gi|324966845|gb|ADY57624.1| chromosome segregation ATPase [Syntrophobotulus glycolicus DSM
           8271]
          Length = 253

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/252 (45%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ I NQKGGV KTTTA+NL+++L   G  VLLIDLDPQGNA++G G+  +      Y
Sbjct: 2   ARIVAIVNQKGGVAKTTTAVNLASSLVERGSKVLLIDLDPQGNATSGCGVMKHRLSRCIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I +++I  +++ T +  + + P+ ++L G E+ L     R  RL +A+  ++ ++F 
Sbjct: 62  DVIINDEDIRNVILDTELKKMKVAPARIELAGAEIELVSLSQRESRLGQAVK-EIQNEFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA  +L+P+QCE++ALEGLS L+ T+++VR+++N  L++ G
Sbjct: 121 FILIDCPPSLGLLTLNALCAATDVLIPIQCEYYALEGLSLLMNTLDKVRKSLNRELEVLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V++    KV+ T+IPRNVR+SEAPS+G+P I+YD K  G++
Sbjct: 181 VLLTMFDARTNLSIQVVDEVKRYFRDKVFRTIIPRNVRLSEAPSHGQPIILYDTKSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y  LA E++++
Sbjct: 241 VYRDLAEEVLER 252


>gi|110638946|ref|YP_679155.1| chromosome segregation ATPase [Cytophaga hutchinsonii ATCC 33406]
 gi|110281627|gb|ABG59813.1| chromosome segregation ATPase [Cytophaga hutchinsonii ATCC 33406]
          Length = 258

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 179/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTTAINL+ +LAA+    LL+D DPQ N+S+GL +   D +   YD
Sbjct: 3   KIIAIANQKGGVGKTTTAINLAASLAALEHKTLLVDADPQANSSSGLSVNPRDVERGIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            ++E  +  +++IQT I +L ++PS +DL G E+ L   ++R FR+ K L+  +   + +
Sbjct: 63  CMVEGFDPAELIIQTEINHLDLLPSHIDLAGAEIELINLEEREFRMKKTLA-SIKDQYEF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDC PS  L+T+NA+ AADS+L+P+QCE+FALEG+ +LL T+E ++  +N  L I+G+
Sbjct: 122 IILDCSPSLGLITVNALTAADSVLIPVQCEYFALEGIGKLLSTIEIIQEHLNPELHIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TMFDSR  LS QVV +V+K+    ++ T+IPRN+R+SEAPS+G P I +D +  G+Q+
Sbjct: 182 LMTMFDSRMRLSNQVVDEVKKHFEELIFETLIPRNIRLSEAPSFGIPVIAHDAESKGAQS 241

Query: 247 YLKLASELI 255
           Y+ LA E++
Sbjct: 242 YMSLAQEVL 250


>gi|150019903|ref|YP_001312157.1| cobyrinic acid a,c-diamide synthase [Clostridium beijerinckii NCIMB
           8052]
 gi|149906368|gb|ABR37201.1| Cobyrinic acid a,c-diamide synthase [Clostridium beijerinckii NCIMB
           8052]
          Length = 253

 Score =  253 bits (645), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 181/253 (71%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT INL   LA  G  VL ID+DPQGN ++GLG++  +   S YD
Sbjct: 2   KVICIFNQKGGVGKTTTNINLCAYLAMEGYRVLTIDIDPQGNTTSGLGLDKSNLDLSIYD 61

Query: 67  LLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LI +  + + ++++  + NL I PSTM+L G E+ L    DR   +   L  ++ S++ 
Sbjct: 62  VLISDATMKESIVRSDLVQNLYISPSTMELAGAEVELINRSDRENIMKNKLK-EIESEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS  +LT+NA+  ADS+L+P+QCEF+ALEG+SQL+ T++ V++++N  L+I+G
Sbjct: 121 YVFIDCPPSLGVLTINALTCADSVLIPIQCEFYALEGVSQLINTIQLVKKSLNKKLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TMFD R +LS +V+ +V+K    KVY   I RNVR++EAPS+G P ++YD KC G++
Sbjct: 181 VVMTMFDYRTNLSNEVLKEVKKYFKNKVYEATISRNVRLAEAPSFGLPIMLYDEKCKGAE 240

Query: 246 AYLKLASELIQQE 258
           AY+KL  E ++++
Sbjct: 241 AYVKLTKEFLERQ 253


>gi|289579524|ref|YP_003478151.1| cobyrinic acid ac-diamide synthase [Thermoanaerobacter italicus
           Ab9]
 gi|289529237|gb|ADD03589.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter italicus
           Ab9]
          Length = 255

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT INL  +LA  G+ VL ID+DPQ N ++G GI     K+++Y 
Sbjct: 3   KVIAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE+++I   +I      +SI+PS++ L G E+ L     R ++L  A++  +  +F Y
Sbjct: 63  VLIEDEDIKSAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKSAVN-PIKDEFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
             +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N  L+I+G+
Sbjct: 122 TLIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPQLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPS+GKP  IYD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKDKVYRTIIPRNIRLGEAPSFGKPISIYDPNSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y +LA E+I++
Sbjct: 242 YEELALEVIER 252


>gi|148381576|ref|YP_001256117.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A str. ATCC 3502]
 gi|153933036|ref|YP_001385953.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A str. ATCC 19397]
 gi|153937312|ref|YP_001389360.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A str. Hall]
 gi|170760924|ref|YP_001788981.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A3 str. Loch Maree]
 gi|148291060|emb|CAL85197.1| chromosome partitioning protein (sporulation initiation inhibitor
           protein) [Clostridium botulinum A str. ATCC 3502]
 gi|152929080|gb|ABS34580.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           A str. ATCC 19397]
 gi|152933226|gb|ABS38725.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           A str. Hall]
 gi|169407913|gb|ACA56324.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           A3 str. Loch Maree]
          Length = 254

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 185/254 (72%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S YD
Sbjct: 2   KVISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYD 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I + + Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+DS+L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDSKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|297545647|ref|YP_003677949.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296843422|gb|ADH61938.1| Cobyrinic acid ac-diamide synthase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 255

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTT INL  +LA  G+ VL ID+DPQ N ++G GI     K+++Y 
Sbjct: 3   KVIAIANQKGGVGKTTTTINLGYSLATQGKKVLCIDIDPQSNMTSGFGINPASLKHTTYT 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE+++I   +I      +SI+PS++ L G E+ L     R ++L  A++  +  +F Y
Sbjct: 63  VLIEDEDIKSAIIPLKDLKVSIVPSSIQLAGAEIELVPMLSREYKLKSAVN-PIKDEFDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
             +DCPPS  LLT+NA+ AADS++VP+QCE++ALEGL+QL+ T+  V++++N  L+I+G+
Sbjct: 122 TLIDCPPSLGLLTINALTAADSVIVPIQCEYYALEGLTQLMNTINLVKKSLNPQLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF++R +LS QVV +V+K    KVY T+IPRN+R+ EAPS+GKP  IYD    G++A
Sbjct: 182 VLTMFNARTNLSIQVVDEVKKFFKEKVYRTIIPRNIRLGEAPSFGKPISIYDPNSKGAEA 241

Query: 247 YLKLASELIQQ 257
           Y +LA E+I++
Sbjct: 242 YEELALEVIER 252


>gi|328958780|ref|YP_004376166.1| chromosome partitioning protein; transcriptional regulator
           [Carnobacterium sp. 17-4]
 gi|328675104|gb|AEB31150.1| chromosome partitioning protein; transcriptional regulator
           [Carnobacterium sp. 17-4]
          Length = 253

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 177/250 (70%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII++ANQKGGVGKTTT +NL   LA  G+ +LL+D+D QGNA++GLG+   D +   Y
Sbjct: 2   ARIISVANQKGGVGKTTTTVNLGACLAYFGKKILLVDIDAQGNATSGLGVRKSDVEKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E  +  +++ ++  NL ++P+T+ L G E+ L  +  R  RL +AL  ++  D+ 
Sbjct: 62  DILVNETLVKDVVLPSSRENLWVVPATIQLAGAEIELTSQMARESRLKQALE-KVKDDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS   LT+NA  A+DSIL+P+QCE++ALEGLSQLL TV  V++  N  L I+G
Sbjct: 121 YILIDCPPSLGHLTINAFTASDSILIPVQCEYYALEGLSQLLNTVRLVQKHFNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D+R +L  +VV +V+K    +VY T+IPRN+R+SEAPS+G   I YD +  G++
Sbjct: 181 VLLTMLDARTNLGYEVVDEVKKYFRERVYKTIIPRNIRLSEAPSHGLSIIDYDARSRGAE 240

Query: 246 AYLKLASELI 255
            YL+LA E++
Sbjct: 241 VYLELAKEVL 250


>gi|296111117|ref|YP_003621498.1| chromosome partitioning protein, membrane-associated ATPase
           [Leuconostoc kimchii IMSNU 11154]
 gi|295832648|gb|ADG40529.1| chromosome partitioning protein, membrane-associated ATPase
           [Leuconostoc kimchii IMSNU 11154]
          Length = 253

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 182/252 (72%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT++NL  ALA  G+ VLL+D+D QGNA++G G++  + +  SY
Sbjct: 2   AQIIALANQKGGVGKTTTSVNLGAALAQAGKRVLLVDIDAQGNATSGSGVDKSELERDSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++++   I  +++ T   N  ++P+T+ L G E+ L G++ R +RL KAL+  +  D+ 
Sbjct: 62  DVIVDLVPIRDVIVPT--DNYDLMPATIQLSGAEIELAGQEKREYRLKKALAA-VDDDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  LLT+NA  AA++IL+P+Q EF+ALEGL QLL T+E VR+  N  LDI G
Sbjct: 119 FILIDNPPALGLLTVNAFTAANAILIPVQTEFYALEGLGQLLNTIELVRKQFNPELDISG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR   G KVY TVIPR+VR+SEAPSYG+  I +D +  G+Q
Sbjct: 179 ILLTMYDGRTNLAKQVSEEVRNYFGSKVYTTVIPRSVRLSEAPSYGQAIIDFDPRSVGAQ 238

Query: 246 AYLKLASELIQQ 257
            Y +LA E+++Q
Sbjct: 239 VYNELAQEVLKQ 250


>gi|169832367|ref|YP_001718349.1| cobyrinic acid a,c-diamide synthase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169639211|gb|ACA60717.1| Cobyrinic acid a,c-diamide synthase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 254

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 178/253 (70%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            ++I + NQKGGV KTTT +NL  ALA   + VLL+D+DPQGNA++G+G++    K   Y
Sbjct: 2   GKVIAVTNQKGGVAKTTTCVNLGAALALNNKRVLLVDIDPQGNATSGMGLDRNSLKRCIY 61

Query: 66  DLLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           ++LI  + I  ++    ++  + ++P+T+ L G E+ + G  +R   L K L+ ++  D+
Sbjct: 62  NVLIAGEPIRSVMRTCESVSGVDVVPATLQLAGAEIEMVGVPERELLLRKTLA-KVRGDY 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y  +DCPPS  LLT+NA+ AADS+L+P+QCE++ALEGL  L+  V+ V+R +N  L I+
Sbjct: 121 DYTLIDCPPSLGLLTLNALGAADSVLIPIQCEYYALEGLGHLMSAVQLVQRRLNPRLQIE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFD R +L+ QVV +V+++ G KVY T++PRNVR+SEAPS+GKP  +YD KC G+
Sbjct: 181 GVLLTMFDGRTNLAIQVVEEVKRHFGNKVYRTIVPRNVRLSEAPSFGKPVAVYDPKCRGA 240

Query: 245 QAYLKLASELIQQ 257
           + Y  LA E++++
Sbjct: 241 EVYGDLAKEVMER 253


>gi|229824651|ref|ZP_04450720.1| hypothetical protein GCWU000282_01998 [Catonella morbi ATCC 51271]
 gi|229786022|gb|EEP22136.1| hypothetical protein GCWU000282_01998 [Catonella morbi ATCC 51271]
          Length = 253

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 173/248 (69%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I I NQKGGVGKTTT +NL  ALA  G+ VL+ID+D QGNA++GLGIE  D K S Y+
Sbjct: 3   RMIAIGNQKGGVGKTTTTVNLGAALAFQGKKVLIIDMDSQGNATSGLGIERADVKQSVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+++      ++ T+  NL I+PST+ L G E+ L     R  RL +A+   + +D+ Y
Sbjct: 63  VLVDQIEAAGAILPTSRENLWILPSTLQLAGAEIELATADHRESRLKQAIE-PIKADYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS   L++NA  A+D+IL+P+QCE++ALEGLSQLL T+  V+RT N    I+G+
Sbjct: 122 ILVDCPPSLGQLSLNAFTASDTILIPVQCEYYALEGLSQLLNTIRLVQRTYNKNFRIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  +VV +VRK    KVY T+I RNVR+SEAPSYG+  I YD K  G++ 
Sbjct: 182 LLTMLDARTNLGYEVVEEVRKYFQEKVYQTIITRNVRLSEAPSYGQSVIDYDPKSRGAEM 241

Query: 247 YLKLASEL 254
           Y+ LA E+
Sbjct: 242 YMDLAKEV 249


>gi|298529220|ref|ZP_07016623.1| Cobyrinic acid ac-diamide synthase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510656|gb|EFI34559.1| Cobyrinic acid ac-diamide synthase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 254

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/247 (46%), Positives = 176/247 (71%), Gaps = 1/247 (0%)

Query: 9   ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68
           I +ANQKGGVGKTTTA+NL+ +LA + + VLL+D D Q NAS+GLG+++   +YS Y  L
Sbjct: 5   IVVANQKGGVGKTTTAVNLAASLAVMEKKVLLVDCDAQANASSGLGLDIDSLEYSLYHGL 64

Query: 69  IEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIF 128
             E    +++  T +  L IIPS  DL+ +E+ L   +DR + L K L   ++  + YI 
Sbjct: 65  TGEAEPEKLIRPTEMKYLDIIPSNKDLVAVELELNDRQDREYYLYKLLK-NVSKPYEYII 123

Query: 129 LDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIIL 188
           LDCPPS  ++T+NAM A++ +LVP+QCE++ALEG+++L ET E +R+ +N+ L++ G+ L
Sbjct: 124 LDCPPSLGMITINAMCASNRLLVPMQCEYYALEGIARLFETYELIRKRLNNDLELLGVAL 183

Query: 189 TMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYL 248
           TMFD RN L  QV+ ++R++   +  +++IPRNVR+SEAPS+G+P + YD++  GS AYL
Sbjct: 184 TMFDKRNKLCHQVIKEIRRHFQAQTMDSIIPRNVRLSEAPSHGRPVLAYDIRSTGSHAYL 243

Query: 249 KLASELI 255
           +LA E++
Sbjct: 244 RLAREVV 250


>gi|323486764|ref|ZP_08092083.1| hypothetical protein HMPREF9474_03834 [Clostridium symbiosum
           WAL-14163]
 gi|323694906|ref|ZP_08109056.1| sporulation initiation inhibitor protein Soj [Clostridium symbiosum
           WAL-14673]
 gi|323399903|gb|EGA92282.1| hypothetical protein HMPREF9474_03834 [Clostridium symbiosum
           WAL-14163]
 gi|323500996|gb|EGB16908.1| sporulation initiation inhibitor protein Soj [Clostridium symbiosum
           WAL-14673]
          Length = 256

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R I IANQKGGVGKTTTAINLS+ LA  G+ VL ID DPQGNA++GLG+E    + + Y+
Sbjct: 3   RTIAIANQKGGVGKTTTAINLSSCLAEAGQRVLTIDFDPQGNATSGLGLEKGQIEDTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++ + +    L +    +L ++PS  +L G E+ L   +++ F L   L  Q+ +D+ +
Sbjct: 63  MMLGDCSFEDCLQREVQEDLDVLPSDSNLSGAEIELLDVENKEFVLKSHLD-QVKNDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS +LLT+NA+ AAD++LVP+QCE++ALEGLSQ+L T+  V+R +N +L+++G+
Sbjct: 122 IIIDCPPSLSLLTLNALVAADTVLVPIQCEYYALEGLSQVLRTINIVKRKMNPSLEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV +V+ NL  K+Y T+IPRNVR++EAPS+G P  IYD K  G+++
Sbjct: 182 VFTMYDARTNLSLEVVENVKNNLNEKIYKTIIPRNVRLAEAPSHGMPINIYDSKSTGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA+E+I +
Sbjct: 242 YRLLAAEVISR 252


>gi|168181106|ref|ZP_02615770.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           NCTC 2916]
 gi|168183717|ref|ZP_02618381.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           Bf]
 gi|226951091|ref|YP_002806182.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A2 str. Kyoto]
 gi|237797096|ref|YP_002864648.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           Ba4 str. 657]
 gi|182668106|gb|EDT80085.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           NCTC 2916]
 gi|182673194|gb|EDT85155.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           Bf]
 gi|226844569|gb|ACO87235.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           A2 str. Kyoto]
 gi|229262549|gb|ACQ53582.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           Ba4 str. 657]
          Length = 254

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 185/254 (72%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++++I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S YD
Sbjct: 2   KVVSIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYD 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I + + Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+DS+L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDSKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|71281148|ref|YP_271683.1| parA family protein [Colwellia psychrerythraea 34H]
 gi|71146888|gb|AAZ27361.1| parA family protein [Colwellia psychrerythraea 34H]
          Length = 268

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 179/258 (69%), Gaps = 1/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTTA+NL+ +LAA    VLLIDLDPQGNA+   G++ Y    + Y+
Sbjct: 3   KIIAVANQKGGVGKTTTAVNLAASLAATKRKVLLIDLDPQGNATMASGVDKYQVHATCYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EE+++  ++I+       +I +  D+   E+ L     R  RL  AL+  +   + +
Sbjct: 63  LLVEEQSVEDVVIKETSGLYHLISANADVTAAEIKLMEVYAREQRLKNALA-PVKDFYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS N+LT+NAM AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IIIDCPPSLNMLTVNAMTAADSVLVPMQCEYYALEGLTALMDTITKLTSVVNDKLHIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G KVY +VIPRNVR++EAPS+G PA+ YD    G++A
Sbjct: 182 LRTMYDPRNRLANDVSEQLKRHFGDKVYRSVIPRNVRLAEAPSFGTPAMYYDKSSTGAKA 241

Query: 247 YLKLASELIQQERHRKEA 264
           YL LA E++++  + K++
Sbjct: 242 YLALAGEVLRKNDYAKKS 259


>gi|34496118|ref|NP_900333.1| ParA family chromosome partitioning ATPase [Chromobacterium
           violaceum ATCC 12472]
 gi|34101972|gb|AAQ58339.1| chromosome partitioning protein, ParA family ATPase
           [Chromobacterium violaceum ATCC 12472]
          Length = 263

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 172/251 (68%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTT +NL+  LA +G  VL++DLDPQGNA+ G GI     + S YD
Sbjct: 4   RVIAVANQKGGVGKTTTVVNLAAGLAELGRRVLIVDLDPQGNATMGSGIAKQSLEKSGYD 63

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ E  I +           ++P+  +L G E+ L  E  R  RL  AL+ ++   + Y
Sbjct: 64  VLLGEATIEEARQDAKAGGYQVLPANRNLGGAELELVNELAREARLKNALA-EVAGQYDY 122

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +D PPS NLLT+N + AADS+L+P+ CE++ALEGLS L+ T+ +VR  VN  ++I G+
Sbjct: 123 VLIDSPPSLNLLTLNGLVAADSVLIPMVCEYYALEGLSDLVATLRKVRLAVNPKIEIMGL 182

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD+RN+LSQQV   + ++ G KV+ TVIPRNVR++EAPS+G P ++YD    G+QA
Sbjct: 183 LRTMFDARNNLSQQVSEQLARHFGEKVFQTVIPRNVRLAEAPSHGLPGLVYDRSSRGAQA 242

Query: 247 YLKLASELIQQ 257
           YL LA EL+++
Sbjct: 243 YLALAQELVER 253


>gi|268316023|ref|YP_003289742.1| Cobyrinic acid ac-diamide synthase [Rhodothermus marinus DSM 4252]
 gi|262333557|gb|ACY47354.1| Cobyrinic acid ac-diamide synthase [Rhodothermus marinus DSM 4252]
          Length = 295

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 184/252 (73%), Gaps = 5/252 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTAINL+ +LAAI    LLID+DPQ N S+G+GI     + S+Y+
Sbjct: 3   KVIAIANQKGGVGKTTTAINLAASLAAIEHPTLLIDIDPQANCSSGVGINPRTVQKSTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSDF 124
           +LI + ++ + +  T +P L ++PS ++L+G  IEMI   E++R+  L  AL  +    +
Sbjct: 63  VLIGDISLEEAIQPTELPFLEVVPSHINLVGAEIEMIDVMERERI--LANALR-RARRKY 119

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            +I +DCPPS  LLT+NA+ AA+S+L+P+Q E+FALEGL QLL T++ VR+ +N  L+I+
Sbjct: 120 DFIIIDCPPSLGLLTLNALTAANSVLIPVQAEYFALEGLGQLLNTIKIVRQHLNPELEIE 179

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++LTMFD+R  LS QV  +VR+  G KV+ T++ RNVR+SEAPS+G+P ++YD+   G+
Sbjct: 180 GVLLTMFDTRLRLSNQVAEEVRRYFGDKVFRTIVQRNVRLSEAPSFGRPVLLYDITSVGA 239

Query: 245 QAYLKLASELIQ 256
           + Y+ LA E+IQ
Sbjct: 240 RNYMALAREIIQ 251


>gi|283797203|ref|ZP_06346356.1| sporulation initiation inhibitor protein Soj [Clostridium sp.
           M62/1]
 gi|291075165|gb|EFE12529.1| sporulation initiation inhibitor protein Soj [Clostridium sp.
           M62/1]
 gi|295090263|emb|CBK76370.1| ATPases involved in chromosome partitioning [Clostridium cf.
           saccharolyticum K10]
 gi|295115464|emb|CBL36311.1| ATPases involved in chromosome partitioning [butyrate-producing
           bacterium SM4/1]
          Length = 255

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I IANQKGGVGKTTTAINLS  LA  G+ VL ID DPQGNA+TGLG+E    + + Y+
Sbjct: 3   RVIAIANQKGGVGKTTTAINLSACLAEAGQKVLAIDFDPQGNATTGLGLEKEYMEETVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++ E +++  L +    NL ++PS  +L G E+ L   + + F L   L  ++  ++ +
Sbjct: 63  MMLGECSLDDCLHEQVQENLDVLPSDSNLAGAEIELLDMEQKEFILRDHLE-EVRDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS +LLT+NA+ AAD++LVP+QCE++ALEGLSQ+L T+  V++T+N  L+++G+
Sbjct: 122 IIIDCPPSLSLLTINALTAADTVLVPIQCEYYALEGLSQVLRTIGLVKKTMNPGLELEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS +VV +V+ NL   +Y T+IPRNVR++EAPS+G P  +YD K  G+++
Sbjct: 182 VFTMYDARTNLSLEVVENVKSNLNETIYKTIIPRNVRLAEAPSHGMPINLYDSKSTGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA+E+I +
Sbjct: 242 YRLLAAEVISR 252


>gi|160944282|ref|ZP_02091511.1| hypothetical protein FAEPRAM212_01791 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444464|gb|EDP21468.1| hypothetical protein FAEPRAM212_01791 [Faecalibacterium prausnitzii
           M21/2]
          Length = 292

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 180/259 (69%), Gaps = 3/259 (1%)

Query: 2   EEKK-SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR 60
           EEK+ ++I+ IANQKGGVGKTTTA+NLS+ +AA+G+ VL++DLDPQGN +TG GI     
Sbjct: 12  EEKRVAKIVAIANQKGGVGKTTTAVNLSSCVAALGKKVLIVDLDPQGNTTTGYGIPKRSV 71

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120
           +  +Y++LI +    Q +  T      +I S   L G  + +     R  RL KAL+ ++
Sbjct: 72  EAGTYEVLIGKATAAQAIRHTEY-RTDVIGSNTRLAGASLEMIDLPGREGRLRKALA-EV 129

Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180
             D+ +IF+DCPPS +LLT+N ++A DS+L+P+QCE++ALEGLS+L+ T++ +R+  N  
Sbjct: 130 QKDYDFIFIDCPPSLDLLTLNGLSACDSVLIPVQCEYYALEGLSELISTLKTIRKKYNPY 189

Query: 181 LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLK 240
           LDI+G++ TMF  R +L+ QVV  V+K  G KVY T IPR++RISEAPSYG+P   Y+ K
Sbjct: 190 LDIEGVVFTMFSLRYNLTVQVVEQVQKYFGSKVYKTTIPRSIRISEAPSYGQPINFYEPK 249

Query: 241 CAGSQAYLKLASELIQQER 259
             GS+AY+ LA E ++  R
Sbjct: 250 GKGSEAYMDLAIEFVKHNR 268


>gi|118443230|ref|YP_876983.1| sporulation initiation inhibitor protein soj [Clostridium novyi NT]
 gi|118133686|gb|ABK60730.1| Sporulation initiation inhibitor protein soj [Clostridium novyi NT]
          Length = 261

 Score =  251 bits (642), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 178/253 (70%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT INL   LA  G  VL ID+DPQGN ++GLGI+    KYS+YD
Sbjct: 2   KVICIFNQKGGVGKTTTNINLCANLAMHGHKVLSIDIDPQGNTTSGLGIDKNKIKYSTYD 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L  + +I + +I++  I N  ++PS MDL+G E+ L   K R   L + +   +   F 
Sbjct: 62  VLTSDISIEEAIIESELIDNFYVVPSNMDLVGAEVELIDVKGRETILKRKIE-SIKDKFE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  +LT+N++ AA S+L+P+QCEF+ALEG+ QLL T++ V++++N  L+++G
Sbjct: 121 YIFIDCPPSLGVLTINSLIAATSVLIPIQCEFYALEGVGQLLNTIQLVKKSLNKDLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++++M+D+R  L  +V  +V K    KVYNT IPRNVR++EAPS+G P ++YD KC G++
Sbjct: 181 VVMSMYDNRTKLCNEVAQEVIKYFKDKVYNTTIPRNVRLAEAPSFGLPIVLYDDKCKGAE 240

Query: 246 AYLKLASELIQQE 258
           AY  L +E + ++
Sbjct: 241 AYRDLLNEFLSRQ 253


>gi|88811302|ref|ZP_01126558.1| ParA family protein [Nitrococcus mobilis Nb-231]
 gi|88791841|gb|EAR22952.1| ParA family protein [Nitrococcus mobilis Nb-231]
          Length = 262

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 183/253 (72%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII +ANQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G G++  D + ++Y
Sbjct: 2   ARIIAVANQKGGVGKTTTCVNLAASLAANRRRVLLVDMDPQGNATIGSGLDKDDLEVTNY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+++ + L + A P   ++P+  DL   E+ L     R  RL + L   L  +++
Sbjct: 62  DILMRERSVAEALHRLAPPGYDLLPANGDLTVAEVALMDSAGRERRLRELLQ-PLLDEYA 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS N+LT+NA+ AA  +L+P+QCE++ALEGLS LL+T+ +++ +VN  L+I+G
Sbjct: 121 YVLIDCPPSLNILTVNALVAAHRVLIPIQCEYYALEGLSALLDTIRQIQGSVNRELEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+ QV + + ++   KVY T+IPRNVR++EAPS+G PA+ YD    G+ 
Sbjct: 181 LLRTMFDPRNNLANQVGAQLIQHFADKVYRTLIPRNVRLAEAPSHGMPALQYDRTSRGAI 240

Query: 246 AYLKLASELIQQE 258
           AY+ LASE++++E
Sbjct: 241 AYMALASEMLRRE 253


>gi|332520987|ref|ZP_08397447.1| cobyrinic acid a,c-diamide synthase [Lacinutrix algicola 5H-3-7-4]
 gi|332043517|gb|EGI79713.1| cobyrinic acid a,c-diamide synthase [Lacinutrix algicola 5H-3-7-4]
          Length = 254

 Score =  251 bits (642), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ N+++GLG+++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANSTSGLGLDVEAVEIGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL    +    +I T  PNL IIP+ +DL+ IE+ L  +  R + + +AL   +  D+ Y
Sbjct: 63  LLEHTNSAKDAIISTNTPNLDIIPAHIDLVAIEIELVDKDQREYMMKRALEA-IKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AAD++++P+QCE+FALEGL +LL T++ V++  NSALDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADAVIIPIQCEYFALEGLGKLLNTIKSVQKIHNSALDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ T+I RNV++SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFNDMVFETIIQRNVKLSEAPSYGENIINYDASSKGAAN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I +
Sbjct: 242 YLSLAKEIINK 252


>gi|154503061|ref|ZP_02040121.1| hypothetical protein RUMGNA_00883 [Ruminococcus gnavus ATCC 29149]
 gi|153796302|gb|EDN78722.1| hypothetical protein RUMGNA_00883 [Ruminococcus gnavus ATCC 29149]
          Length = 255

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTAINLS +LA++G+ VL +D+DPQGN ++GL +   + + + YD
Sbjct: 3   RIIAIANQKGGVGKTTTAINLSASLASLGQKVLALDMDPQGNMTSGLSVNKDEVENTVYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I    I + + +    NL ++PS ++L   E+ L G  ++ + +   +  ++   + Y
Sbjct: 63  LIIGNIGIEECICKEVYENLDVLPSNVNLSAAEIELIGVDNKEYIIKNEVE-KVKDRYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ ++LT+NAM  A+S+LVP+QCE++ALEGLSQL+ T+E V+  +N  L+I+G+
Sbjct: 122 IIIDCPPALSMLTINAMTTANSVLVPIQCEYYALEGLSQLIHTIELVQERLNPKLEIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+ NL   +Y T+IPRNVR++EAPSYG P  +YD K +G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNVRLAEAPSYGMPINLYDPKSSGAES 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I +
Sbjct: 242 YLLLAEEVINK 252


>gi|126667599|ref|ZP_01738568.1| ParA family protein [Marinobacter sp. ELB17]
 gi|126627868|gb|EAZ98496.1| ParA family protein [Marinobacter sp. ELB17]
          Length = 264

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 178/257 (69%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I + NQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G GI+    + S Y
Sbjct: 2   ARVIAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGIDKNALQLSGY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL +  + ++I+I   +    I+P   DL   E+ L  E  R  RL +AL+  L  ++ 
Sbjct: 62  DLLTKRASASEIIIYNEMGGYDIMPGNGDLTAAEVELMTEIGREHRLRQALN-PLRDNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS NLLT+NA++ ADSIL+P+QCE++ALEGL+ L+ TV++++ TVN  L ++G
Sbjct: 121 YVLIDCPPSLNLLTVNALSFADSILIPMQCEYYALEGLAALMNTVQQIQETVNPNLQVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D R+SL++ V   + +  G KVY  VIPRNVR++EAPSYG PA+ YD    G+ 
Sbjct: 181 ILRTMYDPRSSLTRDVSGQLIEFFGDKVYRVVIPRNVRLAEAPSYGMPALKYDKASKGAI 240

Query: 246 AYLKLASELIQQERHRK 262
           AYL LA E++++   +K
Sbjct: 241 AYLALAGEMVRRHGAKK 257


>gi|296125609|ref|YP_003632861.1| cobyrinic acid ac-diamide synthase [Brachyspira murdochii DSM
           12563]
 gi|296017425|gb|ADG70662.1| Cobyrinic acid ac-diamide synthase [Brachyspira murdochii DSM
           12563]
          Length = 254

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/254 (46%), Positives = 175/254 (68%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I I NQKGGVGKTTTA+NLS ++A +G   LLID+DPQ NA  G+GI     K S Y
Sbjct: 2   SKVIAIVNQKGGVGKTTTAVNLSASIAKMGHKTLLIDIDPQANACLGIGITRDKMKKSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLI E +  ++++ T   NL +IP+  DL+G ++ L  E  R ++L KA+   + +D+ 
Sbjct: 62  DLLIGEASTKEVIMPTYQENLFLIPADSDLVGAQIELVNEIAREYKLKKAIET-VKNDYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+  +LT+NA+ AADS+L+P+QCEF+AL+G+++L  T+  V+  +N  L I+G
Sbjct: 121 YIIIDCPPTLGILTLNALTAADSVLIPIQCEFYALDGVAELNNTIALVKENLNKELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R  L+  VV +V      K Y T+IPRNVR+SEAPSYGK    YD  C G++
Sbjct: 181 VLLTMYDARTKLASDVVKEVVNFFKEKTYKTMIPRNVRLSEAPSYGKAISDYDKDCVGAR 240

Query: 246 AYLKLASELIQQER 259
           +Y + A E I++ +
Sbjct: 241 SYREFAKEFIEKSK 254


>gi|169825317|ref|YP_001692928.1| chromosome partitioning protein ParA-like protein [Finegoldia magna
           ATCC 29328]
 gi|167832122|dbj|BAG09038.1| chromosome partitioning protein ParA homolog [Finegoldia magna ATCC
           29328]
          Length = 273

 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 121/249 (48%), Positives = 174/249 (69%), Gaps = 2/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I + NQKGGVGKTTT +NLS AL   G+ VL++DLDPQGN ++G GI  ++ + S YD
Sbjct: 27  KTICVFNQKGGVGKTTTVVNLSAALGLKGKKVLVVDLDPQGNTTSGFGINKFELQKSVYD 86

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L++ E      +I+T   N+ IIP+T DL G+E+ L    D+   L K LS    S + +
Sbjct: 87  LMVHEDFDEDFIIKTEEKNVDIIPATSDLSGVEVELINTNDKEKVLSKILSN--VSGYDF 144

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
            F+DCPPS   L++NA+ AA+S+L+P+QCEF+ALEG+SQL+ T+  VR ++N  L+I+GI
Sbjct: 145 CFIDCPPSLGTLSINALVAANSVLIPIQCEFYALEGVSQLMNTINLVRSSLNENLEIEGI 204

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +++MFD RN+LS +VV +V+K    KV+ T+IPRN+R++EAPSYG  A+ YD    GS A
Sbjct: 205 VMSMFDGRNNLSLEVVEEVKKYFKDKVFTTMIPRNIRLAEAPSYGMSALSYDKNSKGSIA 264

Query: 247 YLKLASELI 255
           Y +LA E +
Sbjct: 265 YKRLAEEFL 273


>gi|166713820|ref|ZP_02245027.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 265

 Score =  251 bits (641), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA + + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    QI + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAQIRV-TAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALT-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++  + G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTAHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|312868965|ref|ZP_07729145.1| sporulation initiation inhibitor protein Soj [Lactobacillus oris
           PB013-T2-3]
 gi|311095529|gb|EFQ53793.1| sporulation initiation inhibitor protein Soj [Lactobacillus oris
           PB013-T2-3]
          Length = 256

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 175/248 (70%), Gaps = 1/248 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G++VLLIDLDPQGNA++GLGIE  + + S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLADQGQHVLLIDLDPQGNATSGLGIEKRNIEKSVYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI ++ +  ++  ++ P L I P+T++L G E+ L     R  RL  A    +  D+ +I
Sbjct: 64  LINDEPLANVIQHSSHPGLDIAPTTIELSGAEVELTNLMARETRLKDAFG-DVKGDYDFI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  A DSIL+P+Q E++ALEGLSQLL T++ V++  N AL I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNPALKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM+D R +L QQV ++V+K  G +VY TVIPRNVR+SEAPS+G   + YD +  G+  Y
Sbjct: 183 LTMYDKRTNLGQQVNAEVKKFFGNQVYQTVIPRNVRLSEAPSHGLAIVDYDKRSTGAAVY 242

Query: 248 LKLASELI 255
             LA E++
Sbjct: 243 QALAKEVL 250


>gi|153940635|ref|YP_001392995.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           F str. Langeland]
 gi|152936531|gb|ABS42029.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           F str. Langeland]
 gi|295320970|gb|ADG01348.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           F str. 230613]
          Length = 254

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 185/254 (72%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S Y+
Sbjct: 2   KVISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYN 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I + + Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+DS+L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDSKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|313112587|ref|ZP_07798246.1| sporulation initiation inhibitor protein Soj [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310625083|gb|EFQ08379.1| sporulation initiation inhibitor protein Soj [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 303

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 181/261 (69%), Gaps = 3/261 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ IANQKGGVGKTTTA+NLS+ +AA+G+ VL++DLDPQGN +TG GI     +  +Y
Sbjct: 28  AKIVAIANQKGGVGKTTTAVNLSSCVAALGKRVLIVDLDPQGNTTTGYGIPKRSVEKGTY 87

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++LI E   ++ + +T      +I S   L G  + +     R  RL KAL+ ++  D+ 
Sbjct: 88  EILIGEARASEAIRKTEY-RTDVIGSNTRLAGASLEMIDLPARESRLRKALA-EVQKDYD 145

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS +LLT+N ++A DS+L+P+QCE++ALEGLS+L+ T++ +R+  N  LDI+G
Sbjct: 146 FIFIDCPPSLDLLTLNGLSACDSVLIPVQCEYYALEGLSELISTLKTIRKKYNPYLDIEG 205

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMF  R +L+ QVV  V+K  G KVY T IPR++RISEAPSYG+P   Y+ K  GS+
Sbjct: 206 VVFTMFSLRYNLTVQVVEQVQKYFGSKVYKTTIPRSIRISEAPSYGQPINFYEPKGKGSE 265

Query: 246 AYLKLASELIQQER-HRKEAA 265
           AY+ LA E ++  R H  + A
Sbjct: 266 AYMDLAIEFVKNNRPHEPKKA 286


>gi|298208003|ref|YP_003716182.1| SpoOJ regulator protein [Croceibacter atlanticus HTCC2559]
 gi|83850644|gb|EAP88512.1| SpoOJ regulator protein [Croceibacter atlanticus HTCC2559]
          Length = 254

 Score =  251 bits (640), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVESVEIGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L       + +I+T  PNL I+P+ +DL+ IE+ L  + +R + L K +   + + + Y
Sbjct: 63  ILEHTAKPEEAIIKTESPNLDILPAHIDLVAIEIELVDQDEREYMLRKVIR-DIAASYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V+R  N  LDI+G+
Sbjct: 122 VIIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQRIHNKDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D R  LS QVV +V+K+    V++T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDQRLRLSNQVVDEVKKHFEAMVFDTIIQRNVRLSEAPSYGESIINYDAASKGASN 241

Query: 247 YLKLASELIQQ 257
           YL LA ELI++
Sbjct: 242 YLSLAHELIKK 252


>gi|323342287|ref|ZP_08082519.1| sporulation initiation inhibitor protein Soj [Erysipelothrix
           rhusiopathiae ATCC 19414]
 gi|322463399|gb|EFY08593.1| sporulation initiation inhibitor protein Soj [Erysipelothrix
           rhusiopathiae ATCC 19414]
          Length = 265

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 126/263 (47%), Positives = 176/263 (66%), Gaps = 10/263 (3%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT+INLS  LA +G+ VLL+DLDPQGNAS G+G      K S+YD
Sbjct: 3   KIIAVANQKGGVGKTTTSINLSAGLAYLGQKVLLVDLDPQGNASQGVGANRMAIKDSTYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLG-----IEMILGGEKDRLFRLDKALSVQLT 121
           L++ EK ++ I +    P + +IP+T+DL G     +E  +G E     RL K   ++  
Sbjct: 63  LILSEKEVSDIKMSLNTPPMDLIPATIDLAGADLEMVEFKIGRE-----RLLKNKLIKAK 117

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D+ YI +DCPPS  LL  NA+ AADS+++P+QCE++ALEGL+QLL T+  V++  N  L
Sbjct: 118 DDYDYIIIDCPPSLGLLNTNALTAADSVIIPVQCEYYALEGLTQLLSTIRLVQKLFNPDL 177

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            I+G++LTMFD R  LS +V  +VRK    +VY + IPRNV++SEAPS G     YDLK 
Sbjct: 178 KIEGVLLTMFDVRTRLSVEVQQEVRKYFKERVYKSNIPRNVKLSEAPSRGNSIFEYDLKS 237

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
            G++AY  LA E++   + R ++
Sbjct: 238 EGAKAYASLAKEVLSYNKKRSDS 260


>gi|224370268|ref|YP_002604432.1| putative chromosome partitioning protein ParA [Desulfobacterium
           autotrophicum HRM2]
 gi|223692985|gb|ACN16268.1| putative chromosome partitioning protein ParA [Desulfobacterium
           autotrophicum HRM2]
          Length = 252

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 175/252 (69%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++ I I+NQKGGVGKTTTA+NLS ALA  G+  LL+D DPQ NA+T  GI+      S Y
Sbjct: 2   TQTICISNQKGGVGKTTTAVNLSAALAVSGKKTLLVDCDPQANATTATGIDKPHLACSLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
             LI+     +I+I T + NL I+P+ +DL+G E+ +   + R   L + LS  +   + 
Sbjct: 62  HGLIQSNTAREIIIPTQVENLDILPANVDLIGFEVEMMATQGREEVLKRLLS-SVKQTYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ LDCPPS +LLT+NA+ AADS+L+PLQ EFFALEGL QLL T++ ++ ++N +L I+G
Sbjct: 121 YVILDCPPSLSLLTLNALTAADSVLIPLQSEFFALEGLGQLLATIKRIKLSLNPSLKIKG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFD R +L++QVV D  K+    ++ T IPRNV++ EAPS+G P I+YD    G++
Sbjct: 181 ILLTMFDRRTNLARQVVEDAEKHFKEMIFTTRIPRNVKLGEAPSFGMPIIVYDPSSVGAK 240

Query: 246 AYLKLASELIQQ 257
           +YL LA EL+++
Sbjct: 241 SYLDLAKELLER 252


>gi|88802440|ref|ZP_01117967.1| SpoOJ regulator protein [Polaribacter irgensii 23-P]
 gi|88781298|gb|EAR12476.1| SpoOJ regulator protein [Polaribacter irgensii 23-P]
          Length = 260

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 183/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT+I+L+ +L  + + +LLID DPQ NA++GLG+++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSISLAASLGVLEKKILLIDADPQANATSGLGLDVNAVEGGTYH 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L    +  + +++TA PN+ IIP+ +DL+ IE+ L  +++R + L KAL+ ++  D+ Y
Sbjct: 63  VLEHTLSARKAIVKTASPNVDIIPAHIDLVAIEIELVDKQEREYMLKKALA-EVKDDYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+N++ AAD++++P+QCE+FALEGL +LL T++ +++  N  L+I+G+
Sbjct: 122 ILIDCAPSLGLITLNSLVAADAVIIPIQCEYFALEGLGKLLNTIKSIQKIHNPTLEIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +VRK+    V++T+I RN+R+ EAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVDEVRKHFSSMVFDTIIRRNIRLGEAPSYGESIITYDATSKGAVN 241

Query: 247 YLKLASELIQQ 257
           YL LA EL+Q+
Sbjct: 242 YLNLAQELLQK 252


>gi|218781555|ref|YP_002432873.1| Cobyrinic acid ac-diamide synthase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762939|gb|ACL05405.1| Cobyrinic acid ac-diamide synthase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 253

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 173/249 (69%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTA+NLS ALA   +  LL+D DPQGNA+TG+GI+    +YS Y+
Sbjct: 3   QVICIANQKGGVGKTTTAVNLSAALALANKKTLLVDCDPQGNATTGMGIDKNSLEYSLYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI       +++QT I  L+++P+ ++L+G E+ L    +R   L K L+  L   + Y
Sbjct: 63  ALIGMAEPKDVVVQTEIDALAVLPAKIELIGSEVELIDSDNRETALKKVLA-PLVGSYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + LDCPPS +LLT+NAM AA +++VPLQCEF+ALEGL QL +T+  ++ +VN  L I GI
Sbjct: 122 LVLDCPPSLSLLTINAMTAATAMIVPLQCEFYALEGLGQLFQTIRRIKGSVNPGLGIAGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR +LS QV  + + +    V+ T IPRNVR+ EAPS+GKP ++YD    G+ +
Sbjct: 182 LLTMFDSRTNLSSQVAEEAQSHFKDLVFKTRIPRNVRLGEAPSFGKPIVLYDKTSTGAVS 241

Query: 247 YLKLASELI 255
           YL LA E++
Sbjct: 242 YLNLAKEVL 250


>gi|194467505|ref|ZP_03073492.1| Cobyrinic acid ac-diamide synthase [Lactobacillus reuteri 100-23]
 gi|194454541|gb|EDX43438.1| Cobyrinic acid ac-diamide synthase [Lactobacillus reuteri 100-23]
          Length = 256

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 175/256 (68%), Gaps = 3/256 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G+ VLLIDLDPQGNA++GLG+E  + K S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLAETGQRVLLIDLDPQGNATSGLGVEKQNIKQSIYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI E  I  ++ +T+   + I P+T+ L G E+ L     R  RL  +   ++   + +I
Sbjct: 64  LINEVPIEDVIQKTSHEGVDIAPTTIALSGAEVELTNLMARETRLKDSFG-EIRQKYDFI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  A DSIL+P+Q E++ALEGLSQLL T++ VR+  N  L I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVRKHFNPQLKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTMFD R +L QQV S+V+K  G +VY+T+IPRNVR+SEAPS+G   I YD    G+  Y
Sbjct: 183 LTMFDRRTNLGQQVNSEVKKFFGDQVYDTIIPRNVRLSEAPSHGLAIIDYDKNSTGAHVY 242

Query: 248 LKLASELIQQERHRKE 263
            +LA E++    H KE
Sbjct: 243 QQLAKEVL--ANHGKE 256


>gi|328956375|ref|YP_004373708.1| chromosome segregation ATPase [Coriobacterium glomerans PW2]
 gi|328456699|gb|AEB07893.1| chromosome segregation ATPase [Coriobacterium glomerans PW2]
          Length = 266

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 176/254 (69%), Gaps = 1/254 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K +RII I NQKGGVGK+TTA+NL+ AL+ +G   LLID DPQGN+++G GIE  +    
Sbjct: 13  KNTRIIAIINQKGGVGKSTTAVNLAAALSEMGRKTLLIDFDPQGNSTSGFGIEKEELDQC 72

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            YD L+     + ++IQT    + I+P+T+ L G E+ L     R  RL K L   +  +
Sbjct: 73  IYDALLHNTPASDLIIQTNSKRVFIVPATIQLAGAEIELVSTMARETRL-KELIAPVKHE 131

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F +I +DCPPS  LLT+NA+AAADS+L+P+QCE++ALEG+++LLE+++ V+  +N+ L I
Sbjct: 132 FDFILIDCPPSLGLLTINALAAADSVLIPIQCEYYALEGVTKLLESMKMVKGRINTNLTI 191

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            G++LTM+DSR SL+ QVV +VR   G + + T+IPR V++SEAPSYG P   Y     G
Sbjct: 192 YGVVLTMYDSRTSLANQVVEEVRSFFGAETFKTLIPRTVKLSEAPSYGLPITTYAPNNKG 251

Query: 244 SQAYLKLASELIQQ 257
           S+AY+ LA E+I++
Sbjct: 252 SKAYMSLAKEVIKR 265


>gi|170755411|ref|YP_001783274.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           B1 str. Okra]
 gi|169120623|gb|ACA44459.1| sporulation initiation inhibitor protein Soj [Clostridium botulinum
           B1 str. Okra]
          Length = 254

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 185/254 (72%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S Y+
Sbjct: 2   KVISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYN 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I + + Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+DS+L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDSVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDPKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|21244624|ref|NP_644206.1| chromosome partitioning protein [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21110307|gb|AAM38742.1| chromosome partitioning protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 265

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 184/259 (71%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E +  QI + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENSAAQIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|182416764|ref|ZP_02948161.1| sporulation initiation inhibitor protein soj [Clostridium butyricum
           5521]
 gi|237669654|ref|ZP_04529632.1| sporulation initiation inhibitor protein soj [Clostridium butyricum
           E4 str. BoNT E BL5262]
 gi|182379421|gb|EDT76916.1| sporulation initiation inhibitor protein soj [Clostridium butyricum
           5521]
 gi|237654888|gb|EEP52450.1| sporulation initiation inhibitor protein Soj [Clostridium butyricum
           E4 str. BoNT E BL5262]
          Length = 253

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 181/253 (71%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I I NQKGGVGKTTT INL + LA  G  VL ID+DPQGN ++GLGI+  +   S YD
Sbjct: 2   KTICIFNQKGGVGKTTTNINLCSYLAMEGFKVLTIDIDPQGNTTSGLGIDKNNLDCSIYD 61

Query: 67  LLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LI + ++ + ++Q+  + NL I PSTM+L G E+ L  + DR   +   L  ++  ++ 
Sbjct: 62  VLISDVSMKESIVQSDLVNNLFISPSTMELAGAEVELINKSDRENIMKNKLK-EIEDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS  +LT+NA+  ADS+L+P+QCEF+ALEG+SQL+ TV+ V++++N  L+I+G
Sbjct: 121 YVFIDCPPSLGVLTINALTCADSVLIPMQCEFYALEGVSQLMNTVQLVKKSLNKKLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TMFD R +LS +V+ +V+K    KVY T I RN+R++EAPS+G P ++YD KC G++
Sbjct: 181 VLMTMFDYRTNLSNEVLKEVQKYFKDKVYKTTIARNIRLAEAPSFGLPIVLYDNKCKGAE 240

Query: 246 AYLKLASELIQQE 258
           AY  L  E ++++
Sbjct: 241 AYTNLTKEFLKRQ 253


>gi|74318824|ref|YP_316564.1| chromosome segregation ATPase [Thiobacillus denitrificans ATCC
           25259]
 gi|74058319|gb|AAZ98759.1| chromosome partitioning protein ParA [Thiobacillus denitrificans
           ATCC 25259]
          Length = 261

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 181/252 (71%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SRI  IANQKGGVGKTTTA+NL+ +LA +G+ VLL DLDPQGNA+ G GIE      + Y
Sbjct: 2   SRIFAIANQKGGVGKTTTAVNLAASLAELGQRVLLADLDPQGNATMGCGIEKRTALPTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L+ +  +    +++   +  +IPS  +L G E+ L   + R  RL  AL+  +  ++ 
Sbjct: 62  QILLNQVGLADARMRSGPGHFDVIPSNRELAGAEIDLVNLEQRDLRLKTALA-GVADEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ NLLT+NA AAA+++L+P+QCE++ALEGL+ L+ T+++V++ +N  + I+G
Sbjct: 121 FILMDCPPTLNLLTVNAFAAAEAVLIPMQCEYYALEGLTDLVATIKKVKQRLNPDIRIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++  MFD R++L+QQV   ++++ G +VY+TVIPRNVR++EAPS+G P + YD +C G++
Sbjct: 181 LLRVMFDPRSTLAQQVSDQLKQHFGDRVYDTVIPRNVRLAEAPSHGLPVLAYDRQCKGAK 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E +++
Sbjct: 241 AYLDLAEETLRR 252


>gi|152998466|ref|YP_001343301.1| cobyrinic acid ac-diamide synthase [Marinomonas sp. MWYL1]
 gi|150839390|gb|ABR73366.1| Cobyrinic acid ac-diamide synthase [Marinomonas sp. MWYL1]
          Length = 255

 Score =  250 bits (639), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 177/252 (70%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII + NQKGGVGKTTT +NL+ +LAA+   VLLIDLDPQGNA+TG G    +   S Y
Sbjct: 2   ARIIAVTNQKGGVGKTTTCVNLAASLAAMKRRVLLIDLDPQGNATTGSGFTKEELDTSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI    + +++ ++   +  ++P+  DL G E++L     +  RL   L  ++ SDF 
Sbjct: 62  DVLIGSHGVKEVMKKSMPGDYWVLPANGDLTGAEVVLLDLPSKETRLRAGL-YEVDSDFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPP+ N+LT+NA+AA+  +L+P+QCE++ALEGL+ LL+T+  + + +N +L+++G
Sbjct: 121 YILLDCPPALNMLTVNALAASQGVLIPVQCEYYALEGLTALLQTINRITQALNPSLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D R SL+  V S + K+ G KVY+TVIPRN+R++E+PSYG P + Y+ +  G+ 
Sbjct: 181 ILRTMYDPRPSLTHDVSSQLHKHFGSKVYDTVIPRNIRLAESPSYGLPVLHYEKQSRGAI 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E I++
Sbjct: 241 AYLALAGEFIRK 252


>gi|294625186|ref|ZP_06703828.1| chromosome partitioning protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294666110|ref|ZP_06731368.1| chromosome partitioning protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292600505|gb|EFF44600.1| chromosome partitioning protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604124|gb|EFF47517.1| chromosome partitioning protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 265

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    QI + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAQIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|257065512|ref|YP_003145184.1| chromosome segregation ATPase [Slackia heliotrinireducens DSM
           20476]
 gi|256793165|gb|ACV23835.1| chromosome segregation ATPase [Slackia heliotrinireducens DSM
           20476]
          Length = 348

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/252 (49%), Positives = 176/252 (69%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II I NQKGGVGK+TTAINLS AL  +G+ VLL+DLDPQGNA++GLGI+    +   Y
Sbjct: 97  TKIIAILNQKGGVGKSTTAINLSAALGELGKQVLLVDLDPQGNATSGLGIDKGQLEACIY 156

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+++ E+ I  ++I      L I PST++L G E+ L     R  RL +A+  ++   + 
Sbjct: 157 DVIVSERPITDVIIPDVCDGLDIAPSTINLAGAEVELVSMMAREVRLKEAIG-EMRGKYD 215

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LL++++ V+  +N +LDI G
Sbjct: 216 YIFIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLDSMKRVKNYLNPSLDIFG 275

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D R +LS+QV S+VRK     V+   IPR V+ISEAPSYG P   YD    G+ 
Sbjct: 276 VLLTMSDRRTTLSKQVASEVRKYFPKTVFEVEIPRTVKISEAPSYGMPITQYDPNGKGAL 335

Query: 246 AYLKLASELIQQ 257
           AY  LA E+I++
Sbjct: 336 AYKTLAQEVIRR 347


>gi|23100942|ref|NP_694409.1| sporulation initiation inhibitor [Oceanobacillus iheyensis HTE831]
 gi|22779177|dbj|BAC15443.1| sporulation initiation inhibitor [Oceanobacillus iheyensis HTE831]
          Length = 257

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 179/256 (69%), Gaps = 2/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+IANQKGGVGKTT+++NLS  LA++G  VLL+D DPQGNA++G+G+   D     Y+
Sbjct: 3   KIISIANQKGGVGKTTSSVNLSACLASLGNRVLLVDTDPQGNATSGVGVNKADVSQCIYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+E+    ++++ + +  L IIP+T+ L G E+ L     R  RL  A+   +   + +
Sbjct: 63  ILVEDATAEEVIVHSEMEQLDIIPATIQLAGAEIELVPIISREIRLKSAIEA-VKDQYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NA+ A+D++++P+QCE++ALEGLSQLL T+  V++ +N  L I+G+
Sbjct: 122 IIIDCPPSLGLLTINALTASDTVMIPVQCEYYALEGLSQLLNTIRLVQKHLNQQLMIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +L  QV+ +V+K    KVY T+IPRNVR+ EAPS+G P I YD K  G++ 
Sbjct: 182 LLTMLDARTNLGIQVIEEVKKYFQDKVYQTIIPRNVRLGEAPSHGLPIISYDPKSRGAEV 241

Query: 247 YLKLASELIQQ-ERHR 261
           YL LA E++   ER R
Sbjct: 242 YLDLAKEVMANGERVR 257


>gi|188578887|ref|YP_001915816.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523339|gb|ACD61284.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 265

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA + + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    QI + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAQIRV-TAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALT-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRGNLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++  + G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTAHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LASE+++++    +A
Sbjct: 240 AYLGLASEIVRRQNDHNKA 258


>gi|331268198|ref|YP_004394690.1| Cobyrinic acid a,c-diamide synthase [Clostridium botulinum
           BKT015925]
 gi|329124748|gb|AEB74693.1| Cobyrinic acid a,c-diamide synthase [Clostridium botulinum
           BKT015925]
          Length = 261

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 179/259 (69%), Gaps = 4/259 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT INL  +LA  G  VL ID+DPQGN ++GLGI+    KYS Y+
Sbjct: 2   KVICIFNQKGGVGKTTTNINLCASLAMDGHKVLAIDIDPQGNTTSGLGIDKSKIKYSIYN 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++  + +I   +I++  I N  I+PS MDL+G E+ L   K R   L + +  +L  +F 
Sbjct: 62  VMTSDISIEDAMIESELINNFFIVPSNMDLVGAEVELIDVKKRETILKRKIE-KLKDEFE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS   LT+NA+ A++S+L+P+QCEF+ALEG+ QL+ T++ V++++N  L ++G
Sbjct: 121 YVFIDCPPSLGFLTINALIASNSVLIPIQCEFYALEGVGQLINTIQLVKKSLNKDLKVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++++M+D+R  L  +V S+V K    KV+ T IPRN+R++EAPS+G P I+YD KC G++
Sbjct: 181 VLMSMYDNRTKLCNEVASEVNKYFKDKVFKTSIPRNIRLAEAPSFGLPIILYDDKCKGAE 240

Query: 246 AYLKLASELIQQERHRKEA 264
           AY  L  E +  ER  KE 
Sbjct: 241 AYKSLLKEFL--ERQEKEV 257


>gi|291615445|ref|YP_003525602.1| Cobyrinic acid ac-diamide synthase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585557|gb|ADE13215.1| Cobyrinic acid ac-diamide synthase [Sideroxydans lithotrophicus
           ES-1]
          Length = 259

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 179/250 (71%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+I+ I NQKGGVGKTTT++NL+ +L A  + VLLIDLDPQGNA+ G GI+    + + Y
Sbjct: 2   SKILAITNQKGGVGKTTTSVNLAASLGAAKQRVLLIDLDPQGNATMGSGIDKASLQSTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ EK ++++ I++      ++P+  +L G E+ L   + R  RL + L   L  ++ 
Sbjct: 62  DVLLGEKTVDEVRIKSDSCKYDVLPANRELAGAEIELVDVEGREMRLKEELQPVL-HEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+ NLLT+N + AA S+++P+QCE++ALEGLS L+ T+ +VR  +N  L+I+G
Sbjct: 121 YILVDCPPALNLLTLNGLCAAKSVMIPMQCEYYALEGLSDLVNTIRKVRENLNPDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+QQV   ++++ G KVY TVIPRNVR++EAPS+G PA+ +D +  G+ 
Sbjct: 181 LLRTMFDPRNALAQQVSDQLQQHFGDKVYRTVIPRNVRLAEAPSFGIPALYHDSQSKGTL 240

Query: 246 AYLKLASELI 255
           AYL LA E++
Sbjct: 241 AYLALAGEML 250


>gi|118594206|ref|ZP_01551553.1| Cobyrinic acid a,c-diamide synthase [Methylophilales bacterium
           HTCC2181]
 gi|118439984|gb|EAV46611.1| Cobyrinic acid a,c-diamide synthase [Methylophilales bacterium
           HTCC2181]
          Length = 256

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 179/256 (69%), Gaps = 1/256 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII+I+NQKGGVGKTTT +NL+ +LA   + VLLIDLDPQGNA++G G+       S YD
Sbjct: 2   RIISISNQKGGVGKTTTTVNLAASLAVNKKKVLLIDLDPQGNATSGAGLNKAVLSSSIYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE+K I  +++ +      + P+   L G E+ L   K+R F L KA+   L  ++ +
Sbjct: 62  VLIEQKTIKDVVLHSEDGLFDVAPANQSLAGAEIELVDIKNREFILKKAIET-LALNYDF 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ NLLT+NA+ A++S+L+P+QCE++ALEGLS L+ T+  V++ +N  ++I+G+
Sbjct: 121 ILIDCPPALNLLTVNALVASNSVLIPMQCEYYALEGLSDLVNTIRRVKKNLNPEIEIEGL 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + T+FD RN+L++QV   +  + G KVY T+IPRNVR++EAPS+GK  I YD    G++A
Sbjct: 181 LRTLFDKRNTLTKQVSDQLSSHFGPKVYETIIPRNVRLAEAPSHGKSVISYDKSSKGAKA 240

Query: 247 YLKLASELIQQERHRK 262
           YL LA E+++   + K
Sbjct: 241 YLALAKEILRDRNNEK 256


>gi|228472787|ref|ZP_04057545.1| SpoOJ regulator protein [Capnocytophaga gingivalis ATCC 33624]
 gi|228275838|gb|EEK14604.1| SpoOJ regulator protein [Capnocytophaga gingivalis ATCC 33624]
          Length = 256

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTT++INL+ AL  + + VLLID DPQ NA++GLGIE+   K  +YD
Sbjct: 3   KIIAIANQKGGVGKTTSSINLAAALGVLEKKVLLIDADPQANATSGLGIEVEGVKRGTYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L         ++ T+ PNL +I + +DL+ IE+ L  +  R ++L +AL+  +   + Y
Sbjct: 63  VLEHSATAESAILPTSSPNLDLIAAHIDLVAIEIELVDKSRREYKLKEALA-PIKDRYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V++  N ALDI+G+
Sbjct: 122 IIIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQKLHNPALDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ TVI RN+R+SEAPS+G+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFSEMVFETVIQRNIRLSEAPSFGETIISYDAASKGAAN 241

Query: 247 YLKLASELIQQ 257
           Y+ LA E+I++
Sbjct: 242 YISLAEEIIKK 252


>gi|218134362|ref|ZP_03463166.1| hypothetical protein BACPEC_02256 [Bacteroides pectinophilus ATCC
           43243]
 gi|217989747|gb|EEC55758.1| hypothetical protein BACPEC_02256 [Bacteroides pectinophilus ATCC
           43243]
          Length = 255

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 182/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGK+TTAINL+  LA   + VL++D+DPQGNA++GLG+   D + + Y 
Sbjct: 3   RIIAIANQKGGVGKSTTAINLAACLAEKEQKVLIVDIDPQGNATSGLGVSKDDVENTIYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +++   + +  + +    NL ++PS ++L G E+ L   ++R + L K +   +   + Y
Sbjct: 63  VMLGTISADDAIQKDVFDNLDVLPSNVNLAGAEIELIDVENREYIL-KNILYDIKDRYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDCPPS ++LT+NAM AAD++LVP+QCE++ALEGL+QL+ T+  V+R +N  L+++G+
Sbjct: 122 IVLDCPPSLSMLTVNAMTAADTVLVPIQCEYYALEGLTQLIHTINLVKRKLNPELELEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V++NLG  +Y T+IPRNVR++EAPS+G P  IYD K AG+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKENLGQNIYKTIIPRNVRLAEAPSHGLPINIYDSKSAGAES 241

Query: 247 YLKLASELIQQ 257
           Y  LA E++ Q
Sbjct: 242 YRLLAEEVMNQ 252


>gi|242277483|ref|YP_002989612.1| cobyrinic acid ac-diamide synthase [Desulfovibrio salexigens DSM
           2638]
 gi|242120377|gb|ACS78073.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio salexigens DSM
           2638]
          Length = 254

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/255 (48%), Positives = 178/255 (69%), Gaps = 3/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++ I +ANQKGGVGKTTT+INLS +LA + + VLL+D DPQGN S+GLG    D + + Y
Sbjct: 2   AKRIVVANQKGGVGKTTTSINLSASLAVMEKKVLLVDCDPQGNGSSGLGFYPGDSRENVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L E +     + QT IP LS++P++ DL+G E+ L  +  R + L K L   +  ++ 
Sbjct: 62  SVLFEPERARDAIYQTDIPYLSLMPASQDLVGAEIELIDKMGREYYL-KDLVETVDDEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI  DCPPS  LLT+NA+ AA  +LVPLQ E++ALEG++QLL T E V++ +N  L + G
Sbjct: 121 YIIFDCPPSLGLLTVNALCAAKELLVPLQTEYYALEGVAQLLMTFELVKKRLNPDLSVLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN L++QV ++VRK     ++ T++PRNVR+SEAPS+GKPAI YD K  G+ 
Sbjct: 181 VVLTMYDKRNRLARQVKNEVRKAFPDSLFETIVPRNVRLSEAPSFGKPAISYDAKSNGAL 240

Query: 246 AYLKLASELIQQERH 260
           AY+ LA E+++  RH
Sbjct: 241 AYISLAQEVVK--RH 253


>gi|329769238|ref|ZP_08260657.1| sporulation initiation inhibitor protein soj [Gemella sanguinis
           M325]
 gi|328839369|gb|EGF88949.1| sporulation initiation inhibitor protein soj [Gemella sanguinis
           M325]
          Length = 252

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 179/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ I NQKGGVGKTTTAINL+ +LA + + VLLID DPQ NA++G+G++    + S YD
Sbjct: 2   KILAICNQKGGVGKTTTAINLAASLAHLKKKVLLIDTDPQANATSGVGVDKATVEQSVYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L++E +IN ++ +TA  NL I+PS++ L G E+ L     R  RL  A+S +++  + Y
Sbjct: 62  ILVDEVDINDVITKTAYENLDIVPSSIALAGAEVELVSAISREQRLKNAIS-EVSGKYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  L+T+N++ AA  +++P+Q E++ALEGLSQL+ T   V++ +NS LDI G+
Sbjct: 121 IIIDCPPSLGLITLNSLTAASGVIIPVQTEYYALEGLSQLMNTFNIVKKHLNSKLDIFGV 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM DSR ++S QV   VR++  GK +NTVI R VR+SEAPS+G+P I Y     G++ 
Sbjct: 181 LLTMTDSRTNISNQVGEQVREHFKGKAFNTVIARTVRLSEAPSFGEPIIEYAKNSNGAKQ 240

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 241 YLSLAKEVIER 251


>gi|78043660|ref|YP_358881.1| sporulation initiation inhibitor protein soj [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77995775|gb|ABB14674.1| sporulation initiation inhibitor protein soj [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 254

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 177/257 (68%), Gaps = 4/257 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II +ANQKGGV KTTTAINL  ALA  G+ VLL+D DPQ N ++GLG        + Y
Sbjct: 2   GKIIAVANQKGGVAKTTTAINLGAALALAGKKVLLVDTDPQANMTSGLGFPKEGLPVTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L++      +L +T I  L +IPST++L G E+ L   ++R  RL K L   L   + 
Sbjct: 62  DMLVDGFKEEGVL-ETEISGLYLIPSTVELAGAEIELVMLEERELRLKKVLH-PLKDKYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y  +D PPS  L+T+N +AAAD+IL+P+QCE++ALEG++QL+ T++ V++ +N  L I+G
Sbjct: 120 YTLIDSPPSLGLITLNGLAAADTILIPIQCEYYALEGVTQLINTIDLVKKRLNPDLKIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD R +LS QVV +V+    G VY TVIPRNVR+SEAPSYGKP  +YD KC G++
Sbjct: 180 VLLTMFDGRTNLSIQVVEEVKGFFKGLVYGTVIPRNVRLSEAPSYGKPIFLYDPKCRGAE 239

Query: 246 AYLKLASELIQQERHRK 262
            Y +LA E++  ER+ K
Sbjct: 240 VYHELAKEVM--ERNEK 254


>gi|284097364|ref|ZP_06385488.1| ATPase, ParA family [Candidatus Poribacteria sp. WGA-A3]
 gi|283831129|gb|EFC35115.1| ATPase, ParA family [Candidatus Poribacteria sp. WGA-A3]
          Length = 484

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 174/253 (68%), Gaps = 3/253 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ IANQKGGVGKTTT++NL+ ALA   + VLL+D+DPQ NA++G+GIE   R    YD
Sbjct: 3   KIVAIANQKGGVGKTTTSVNLAAALALCEQKVLLVDIDPQANATSGVGIEAPARTL--YD 60

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L +       ++ TA+  L ++PS  DL G E+ L G   R  RL + L+  +T  + +
Sbjct: 61  CLFKSIPAADSIVATAVSQLDLLPSGPDLAGAEVELAGVAQREERLKRVLTT-MTDQYHF 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I LDCPP+  LLT+NA+ AA S+LVP+QCE+FA+EGL +L+ T+E VRR+ N  L I+GI
Sbjct: 120 IILDCPPALGLLTVNALTAAQSVLVPVQCEYFAMEGLGRLMSTIERVRRSFNQDLAIEGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM D+R +LS+QV  +VRK    KVY +VIPRNV ++EAPSYG+P ++Y+    G++A
Sbjct: 180 LLTMCDARLTLSRQVSEEVRKFSPDKVYQSVIPRNVALAEAPSYGRPGLLYNSASIGAKA 239

Query: 247 YLKLASELIQQER 259
           Y+ L     + E+
Sbjct: 240 YMDLQRSFWEMEK 252


>gi|300779354|ref|ZP_07089212.1| sporulation initiation inhibitor protein Soj [Chryseobacterium
           gleum ATCC 35910]
 gi|300504864|gb|EFK36004.1| sporulation initiation inhibitor protein Soj [Chryseobacterium
           gleum ATCC 35910]
          Length = 257

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 180/250 (72%), Gaps = 3/250 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II IANQKGGVGKTTTA+NL+ AL  + + +L+ID DPQ NA++GLG+E  D +YS+Y
Sbjct: 2   AKIIGIANQKGGVGKTTTAVNLAAALGVLEKRILIIDADPQANATSGLGVE--DVQYSTY 59

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LL    +    + +TA PNL IIPS +DL+  E+ L  ++DR + L KAL+  +  D+ 
Sbjct: 60  NLLEHSADTRVCIKRTATPNLDIIPSHIDLVAAEIELVDKEDREYMLKKALA-SVRDDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DC PS  L+T+NA+ AADS+++P+QCE+FALEGL +LL TV+ V++  N  L I+G
Sbjct: 119 YIIIDCAPSLGLITVNALTAADSVIIPIQCEYFALEGLGKLLNTVKNVQKIHNKDLGIEG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+DSR  LS QVV +V  +    V+ T+I RNVR+SEAPS+G+  + YD +  G+ 
Sbjct: 179 LLLTMYDSRLRLSNQVVEEVNLHFPEMVFETIISRNVRLSEAPSFGESILNYDAESKGAV 238

Query: 246 AYLKLASELI 255
            Y++LA E++
Sbjct: 239 QYIQLAEEVL 248


>gi|126663385|ref|ZP_01734383.1| regulator protein; cell division inhibitor [Flavobacteria bacterium
           BAL38]
 gi|126625043|gb|EAZ95733.1| regulator protein; cell division inhibitor [Flavobacteria bacterium
           BAL38]
          Length = 254

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NAS+GLGI++   +  SY 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANASSGLGIDVESVEIGSYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L       Q ++  + PN+S+IP+ +DL+ IE+ L  +++R + L +AL   +   + Y
Sbjct: 63  VLEHSATPEQAIVSCSAPNVSVIPAHIDLVAIEIELVDKENREYMLKQALE-SIKDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTAADSVVIPIQCEYFALEGLGKLLNTIKSVQKIHNPNLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ T+I RN+++SEAPS+G+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFNDMVFETIIQRNIKLSEAPSFGESIINYDATSKGASN 241

Query: 247 YLKLASELIQQER 259
           YL LA E+I++ +
Sbjct: 242 YLSLAEEIIKKNQ 254


>gi|148543345|ref|YP_001270715.1| chromosome segregation ATPase [Lactobacillus reuteri DSM 20016]
 gi|184152755|ref|YP_001841096.1| chromosome partitioning protein ParA [Lactobacillus reuteri JCM
           1112]
 gi|227364419|ref|ZP_03848509.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus reuteri MM2-3]
 gi|227543813|ref|ZP_03973862.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus reuteri CF48-3A]
 gi|300908881|ref|ZP_07126344.1| sporulation initiation inhibitor protein Soj [Lactobacillus reuteri
           SD2112]
 gi|325683618|ref|ZP_08163134.1| sporulation initiation inhibitor protein Soj [Lactobacillus reuteri
           MM4-1A]
 gi|148530379|gb|ABQ82378.1| chromosome segregation ATPase [Lactobacillus reuteri DSM 20016]
 gi|183224099|dbj|BAG24616.1| chromosome partitioning protein ParA [Lactobacillus reuteri JCM
           1112]
 gi|227070512|gb|EEI08845.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus reuteri MM2-3]
 gi|227186190|gb|EEI66261.1| chromosome partitioning protein, membrane-associated ATPase
           [Lactobacillus reuteri CF48-3A]
 gi|300894288|gb|EFK87646.1| sporulation initiation inhibitor protein Soj [Lactobacillus reuteri
           SD2112]
 gi|324977968|gb|EGC14919.1| sporulation initiation inhibitor protein Soj [Lactobacillus reuteri
           MM4-1A]
          Length = 256

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/256 (49%), Positives = 175/256 (68%), Gaps = 3/256 (1%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G+ VLLIDLDPQGNA++GLG+E  + K S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLAETGQRVLLIDLDPQGNATSGLGVEKQNIKQSIYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI E  +  ++ +T+   + I P+T+ L G E+ L     R  RL  +   ++   + +I
Sbjct: 64  LINEVPLEDVIQKTSHEGVDIAPTTIALSGAEVELTNLMARETRLKDSFG-EIRQKYDFI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  A DSIL+P+Q E++ALEGLSQLL T++ VR+  N  L I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVRKHFNPQLKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTMFD R +L QQV S+V+K  G +VY+T+IPRNVR+SEAPS+G   I YD    G+  Y
Sbjct: 183 LTMFDRRTNLGQQVNSEVKKFFGDQVYDTIIPRNVRLSEAPSHGLAIIDYDKNSTGAHVY 242

Query: 248 LKLASELIQQERHRKE 263
            +LA E++    H KE
Sbjct: 243 QQLAKEVL--ANHGKE 256


>gi|256381069|ref|YP_003104729.1| cobyrinic acid ac-diamide synthase [Actinosynnema mirum DSM 43827]
 gi|255925372|gb|ACU40883.1| Cobyrinic acid ac-diamide synthase [Actinosynnema mirum DSM 43827]
          Length = 339

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 173/253 (68%), Gaps = 3/253 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + R++T+ANQKGGVGKTT+ +NL+ ALA  G  VL+IDLDPQGNAST LG+E      S 
Sbjct: 77  RRRVLTVANQKGGVGKTTSTVNLAAALAIHGLKVLVIDLDPQGNASTALGVEHRSGTPSV 136

Query: 65  YDLLIEEKNINQILIQ-TAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           Y++LI E +I++   Q TA PNL  +P+T+DL G E+ L     R  RL +ALS +   D
Sbjct: 137 YEVLIGEISISEAAQQSTASPNLYCVPATIDLAGAEIELVSMVARESRLKEALSPEALDD 196

Query: 124 FS--YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
           F   Y+F+DCPPS  LLT+NAM AA  +L+P+QCE++ALEGL QLL  +E V+  +N  L
Sbjct: 197 FQPDYVFIDCPPSLGLLTVNAMCAAQEVLIPIQCEYYALEGLGQLLRNIELVQAHLNPHL 256

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           ++  I+LTM+D R  L+ QV S+VR + G  V  TVIPR+V++SEAP YG+  + YD   
Sbjct: 257 NVSTILLTMYDGRTKLADQVTSEVRGHFGDTVLKTVIPRSVKVSEAPGYGQTILAYDPGS 316

Query: 242 AGSQAYLKLASEL 254
            G+ +YL  A E+
Sbjct: 317 RGAMSYLDAAREI 329


>gi|153007339|ref|YP_001381664.1| cobyrinic acid ac-diamide synthase [Anaeromyxobacter sp. Fw109-5]
 gi|152030912|gb|ABS28680.1| Cobyrinic acid ac-diamide synthase [Anaeromyxobacter sp. Fw109-5]
          Length = 314

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 176/249 (70%), Gaps = 2/249 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RI+TIANQKGGVGKTTTA+NL+ +LAA     LL+D+DPQGNA + LGI   + ++S Y
Sbjct: 57  GRILTIANQKGGVGKTTTAVNLAASLAAAERRTLLVDVDPQGNAGSALGIRRDESEHSIY 116

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++L++   +   + +T +  L ++P++  L+G E+ L     R  RL +A+  Q+  D+ 
Sbjct: 117 EVLVDGVPMASAVRKTELKFLDLVPASRHLVGAELELAEHDARESRLKRAVD-QVARDYE 175

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DCPPS  LLT+N + AA  +++PLQCE++ALEGL+ +L+T+E VR + N  L + G
Sbjct: 176 YVVIDCPPSLGLLTLNGLVAAQGVVIPLQCEYYALEGLADVLKTIELVRASANPGLAVDG 235

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMF S N+LS QV  ++R+    +V+ TVIPRNVR+SEAPS+GKP ++YD+   G Q
Sbjct: 236 IVLTMF-SPNNLSNQVADEIRRTFAEQVFKTVIPRNVRLSEAPSHGKPILLYDVTSKGCQ 294

Query: 246 AYLKLASEL 254
           +YL+LA E+
Sbjct: 295 SYLELAREV 303


>gi|259502033|ref|ZP_05744935.1| sporulation initiation inhibitor protein Soj [Lactobacillus antri
           DSM 16041]
 gi|259169997|gb|EEW54492.1| sporulation initiation inhibitor protein Soj [Lactobacillus antri
           DSM 16041]
          Length = 256

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/248 (49%), Positives = 176/248 (70%), Gaps = 1/248 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G++VLLIDLDPQGNA++GLG+E  + + S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLADQGQHVLLIDLDPQGNATSGLGVEKRNIEKSVYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI+++ +  ++  ++ P L I P+T++L G E+ L     R  RL  A    +  ++ +I
Sbjct: 64  LIDDEPLANVIQHSSHPGLDIAPTTIELSGAEVELTNLMARETRLKDAFG-DVQGEYDFI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  A DSIL+P+Q E++ALEGLSQLL T++ V++  N AL I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLNTIKLVQKHFNPALKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM+D R +L QQV ++V+K  G +VY TVIPRNVR+SEAPS+G   + YD +  G+  Y
Sbjct: 183 LTMYDKRTNLGQQVNAEVKKFFGDQVYQTVIPRNVRLSEAPSHGLAIVDYDKRSTGAAVY 242

Query: 248 LKLASELI 255
             LA E++
Sbjct: 243 QALAKEVL 250


>gi|302381009|ref|ZP_07269470.1| sporulation initiation inhibitor protein Soj [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311230|gb|EFK93250.1| sporulation initiation inhibitor protein Soj [Finegoldia magna
           ACS-171-V-Col3]
          Length = 248

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 175/249 (70%), Gaps = 2/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I + NQKGGVGKTTT +NLS AL   G+ VL++DLDPQGN ++G GI  ++ + S YD
Sbjct: 2   KTICVFNQKGGVGKTTTVVNLSAALGLKGKKVLVVDLDPQGNTTSGFGINKFELQKSIYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L++ E      +I+T   N+ IIP+T DL G+E+ L   +++   L K LS    S + +
Sbjct: 62  LMVHEDFDEDFIIKTEEKNVDIIPATSDLSGVEVELINTENKEKVLSKILSN--VSGYDF 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
            F+DCPPS   L++NA+ AA+S+L+P+QCEF+ALEG+SQL+ T+  VR ++N  L+I+GI
Sbjct: 120 CFIDCPPSLGTLSINALVAANSVLIPIQCEFYALEGVSQLMNTINLVRSSLNENLEIEGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +++MFD RN+LS +VV +V+K    KV+ T+IPRN+R++EAPSYG  A+ YD    GS A
Sbjct: 180 VMSMFDGRNNLSLEVVEEVKKYFKDKVFTTMIPRNIRLAEAPSYGMSALSYDKNSKGSIA 239

Query: 247 YLKLASELI 255
           Y +LA E +
Sbjct: 240 YKRLAEEFL 248


>gi|83815700|ref|YP_444657.1| SpoOJ regulator protein [Salinibacter ruber DSM 13855]
 gi|294506409|ref|YP_003570467.1| SpoOJ regulator protein [Salinibacter ruber M8]
 gi|83757094|gb|ABC45207.1| SpoOJ regulator protein [Salinibacter ruber DSM 13855]
 gi|294342737|emb|CBH23515.1| SpoOJ regulator protein [Salinibacter ruber M8]
          Length = 306

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTAINL+ +LAA     LL+D+DPQ N ++G+GIE  +   S Y+
Sbjct: 3   KVIAIANQKGGVGKTTTAINLAASLAATEHPTLLLDIDPQANCTSGIGIESDEVDNSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI E + +  ++ TA+P L ++PS ++L+G E+ +  E  R   L  AL  ++   + +
Sbjct: 63  VLIGEVDASDAVMSTAMPFLDMMPSHINLVGAEVEIIDETQREKLLSAALP-RIRRKYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+N++ A+DS+L+P+Q E+FALEGL QLL T++ VR+ +N  LDI+G+
Sbjct: 122 IVIDCPPSLGLLTLNSLTASDSVLIPVQAEYFALEGLGQLLNTIKIVRQHLNPDLDIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TMFD+R  LS QV  +VR+  G +V+ T++ RNVR+SEAPS+GKPA++Y+    G+Q 
Sbjct: 182 LMTMFDTRLRLSNQVADEVRRYFGERVFETIVKRNVRLSEAPSFGKPALLYEASSTGAQN 241

Query: 247 YLKLASELIQQERHRKEAA 265
           Y+ LA E++       ++A
Sbjct: 242 YMALAREILAHNEEYLDSA 260


>gi|168187287|ref|ZP_02621922.1| SpoOJ regulator protein [Clostridium botulinum C str. Eklund]
 gi|169294797|gb|EDS76930.1| SpoOJ regulator protein [Clostridium botulinum C str. Eklund]
          Length = 261

 Score =  249 bits (636), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 176/253 (69%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT INL   LA  G  VL ID+DPQGN ++GLGI+    KYS YD
Sbjct: 2   KVICIFNQKGGVGKTTTNINLCANLAMNGHKVLSIDIDPQGNTTSGLGIDKNKIKYSIYD 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L  E +I   +I++  I N  I+PS MDL+G E+ L   K+R   L + +   +   F 
Sbjct: 62  VLTSEVSIEDAIIESELINNFYIVPSNMDLVGAEVELIDVKERETILKRKIQ-SIQDKFE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+N++ AA+S+L+P+QCEF+ALEG+ QL+ T++ V++++N  L+++G
Sbjct: 121 YIFIDCPPSLGFLTINSLIAANSVLIPIQCEFYALEGVGQLINTIQLVKKSLNKDLEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++++M+D+R  L  +V  +V K    KVY T IPRN+R++EAPS+G P ++YD KC G++
Sbjct: 181 VLMSMYDNRTKLCNEVAEEVSKYFKDKVYKTTIPRNIRLAEAPSFGLPIVLYDDKCKGAE 240

Query: 246 AYLKLASELIQQE 258
           AY  L +E + ++
Sbjct: 241 AYRDLLNEFLSRQ 253


>gi|271970549|ref|YP_003344745.1| chromosome partitioning protein; transcriptional regulator
           [Streptosporangium roseum DSM 43021]
 gi|270513724|gb|ACZ92002.1| chromosome partitioning protein; transcriptional regulator
           [Streptosporangium roseum DSM 43021]
          Length = 308

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 171/251 (68%), Gaps = 1/251 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           K+RI T+ANQKGGVGKTTT++NL+ AL+  G+ VL++DLDPQGNAST L IE        
Sbjct: 51  KTRIFTVANQKGGVGKTTTSVNLAAALSMHGQRVLVVDLDPQGNASTALSIEHRGDVPDM 110

Query: 65  YDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           Y +L+E+  + +++ +   +P L   P+T+DL G E+ L     R  RL +AL     ++
Sbjct: 111 YKVLVEDVPLVEVVKEVPDMPGLYCAPATIDLAGAEIELVSMVAREARLQRALGAYKATE 170

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F Y+F+DCPPS  LLT+NA+ AA  +LVP+QCE++ALEGL QLL  V+ VR  +N ALD+
Sbjct: 171 FDYVFIDCPPSLGLLTVNALMAATELLVPIQCEYYALEGLGQLLRNVDLVRAHLNPALDM 230

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
             I+LTM+D R  L+ QV  +VR + G  V  T+IPR+VR+SEAPSYG+  + YD   +G
Sbjct: 231 STILLTMYDGRTRLASQVAEEVRSHFGDTVLTTLIPRSVRVSEAPSYGQSVMTYDPGSSG 290

Query: 244 SQAYLKLASEL 254
           + AY+  A E+
Sbjct: 291 AMAYMDAAREM 301


>gi|325983680|ref|YP_004296082.1| Cobyrinic acid ac-diamide synthase [Nitrosomonas sp. AL212]
 gi|325533199|gb|ADZ27920.1| Cobyrinic acid ac-diamide synthase [Nitrosomonas sp. AL212]
          Length = 254

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 174/250 (69%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ I NQKGGVGKTTT++NL+ +LAA G++VLL+DLDPQ NA+ G G+     K + Y
Sbjct: 2   TKILAITNQKGGVGKTTTSVNLAASLAASGKHVLLVDLDPQANATMGSGVNKQKVKNTVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L+ ++ I  + + +      +IP+  DL G E+ +     R  RL  AL   +  D+ 
Sbjct: 62  HVLMGDQEIQHVRVSSPQGKYDLIPANRDLAGAEVEMVEFSQREARLKAALEA-IAGDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+ N+LT+N + AA ++++P+QCE++ALEGLS L+ T++ VR + NS L I+G
Sbjct: 121 YILIDCPPALNMLTLNGLCAAHAVMIPMQCEYYALEGLSDLVNTIKRVRNSFNSTLRIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN L+QQV   ++K+ G KVY TVIPRNVR++EAP +G P + +D +  G+Q
Sbjct: 181 LLRTMFDPRNILAQQVSDQLQKHFGEKVYRTVIPRNVRLAEAPGFGLPVLYHDGQSKGAQ 240

Query: 246 AYLKLASELI 255
           AYL+LA E++
Sbjct: 241 AYLELAKEIL 250


>gi|150025203|ref|YP_001296029.1| chromosome partitioning protein ParA [Flavobacterium psychrophilum
           JIP02/86]
 gi|149771744|emb|CAL43218.1| Chromosome partitioning protein ParA [Flavobacterium psychrophilum
           JIP02/86]
          Length = 255

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT+INL+ +L  + + VLLID DPQ NAS+GLGI++ + +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSINLAASLGVLEQKVLLIDADPQANASSGLGIDVENVEIGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L       + +I+++ PN+ +IP+ +DL+ IE+ L  +++R + L +AL+  +   + Y
Sbjct: 63  ILEHSNTPEEAIIKSSSPNVDVIPAHIDLVAIEIELVDKENREYMLKQALA-SVKDKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ +ADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 IIIDCAPSLGLLTLNALTSADSVVIPIQCEYFALEGLGKLLNTIKSVQKIHNPELDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V++T+I RN ++SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFNNMVFDTIIQRNTKLSEAPSYGESIINYDATSKGAAN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAHEIIKK 252


>gi|257437749|ref|ZP_05613504.1| sporulation initiation inhibitor protein Soj [Faecalibacterium
           prausnitzii A2-165]
 gi|257199764|gb|EEU98048.1| sporulation initiation inhibitor protein Soj [Faecalibacterium
           prausnitzii A2-165]
          Length = 283

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 178/263 (67%), Gaps = 10/263 (3%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ IANQKGGVGKTTTA+NLS+ +AA+G+  L++DLDPQGN +TG GI        +Y
Sbjct: 2   AKIVAIANQKGGVGKTTTAVNLSSCVAALGKKTLIVDLDPQGNTTTGYGIPKRSVDVGTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMI-LGGEKDRLFRLDKAL-SVQLT 121
           +LLI E      + +T      +I S   L G  +EMI L G   R  RL KAL SVQ  
Sbjct: 62  ELLIGEAEAKDAIRKTEF-RTDVIGSNTRLAGAGLEMIDLPG---RESRLRKALASVQ-- 115

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D+ +IF+DCPPS +LLT+N + A DS+L+P+QCE++ALEGLS+L+ T++ +R+  N  L
Sbjct: 116 KDYDFIFVDCPPSLDLLTLNGLCACDSVLIPIQCEYYALEGLSELISTLKTIRKKYNPYL 175

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           DI+G++ TMF  R +L+ QVV  V+K  G KVY T IPR +RISEAPSYG+P   Y+ K 
Sbjct: 176 DIEGVVFTMFSGRFNLTLQVVDQVKKYFGTKVYKTTIPRTIRISEAPSYGQPINFYEPKG 235

Query: 242 AGSQAYLKLASELIQQERHRKEA 264
            GS+AY+ LA E ++  R  + A
Sbjct: 236 KGSEAYMDLAIEFVKNNRPHEPA 258


>gi|212703774|ref|ZP_03311902.1| hypothetical protein DESPIG_01822 [Desulfovibrio piger ATCC 29098]
 gi|212672742|gb|EEB33225.1| hypothetical protein DESPIG_01822 [Desulfovibrio piger ATCC 29098]
          Length = 261

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 179/256 (69%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII+IANQKGGVGKTTTAINLS ALA + + VLL+D DPQ N+++G+GI   D  +  Y
Sbjct: 2   ARIISIANQKGGVGKTTTAINLSAALAVMEKRVLLVDCDPQANSTSGIGIAQEDLHHDLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
                 +NI++ +  T  P L ++P++ +L+ +E+ L  +  R F L   L   L S++ 
Sbjct: 62  STFYTPENIHESISSTRTPFLDVLPASTNLVAVELELVDKMAREFYLRDCLE-PLGSEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ A+  +L+PLQCEFFALEG+ +LL+T E V++ +N  L++ G
Sbjct: 121 YIIIDCPPSLGLLTLNALCASQELLIPLQCEFFALEGIVKLLQTFELVKKRLNPKLNLLG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+RN L+++V  +V++     ++ TVIPRNVR+SEAPS+GK  I YD+K  G+ 
Sbjct: 181 VVLTMYDARNRLTREVRDEVQRCFPDHLFGTVIPRNVRLSEAPSHGKSIIHYDIKSKGAD 240

Query: 246 AYLKLASELIQQERHR 261
           AYL LA E+  ++  R
Sbjct: 241 AYLNLAKEVALRDPAR 256


>gi|291548776|emb|CBL25038.1| ATPases involved in chromosome partitioning [Ruminococcus torques
           L2-14]
          Length = 256

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 185/253 (73%), Gaps = 3/253 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I IANQKGGVGKTTTAINLS +LA+ G+ VL ID+DPQGN S+GLG++  + + + Y+
Sbjct: 3   RVIAIANQKGGVGKTTTAINLSASLASSGKKVLAIDMDPQGNMSSGLGVDKNEVEKTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSI--IPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           L+I +  I + + +  I  LS+  +PS++DL   E+ L G  ++ + L   +  ++  ++
Sbjct: 63  LIIGKCKIEECICKEPIEKLSVDVLPSSIDLSAAEIELIGVDNKEYILRDEVE-KIKDNY 121

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            +I +DCPP+ ++LT+NAM  +DS++VP+QCE++ALEGLSQL+ T+E V+  +N  L+++
Sbjct: 122 DFIIIDCPPALSMLTINAMTTSDSVIVPIQCEYYALEGLSQLMHTIELVQDRLNPKLEME 181

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++ TM+D+R +LS QVV +V+ NL   +Y T+IPRNVR++EAPSYG P  +YD K  G+
Sbjct: 182 GVVFTMYDARTNLSLQVVENVKDNLNQNIYKTIIPRNVRLAEAPSYGLPINLYDPKSKGT 241

Query: 245 QAYLKLASELIQQ 257
           ++Y+ LA E+I +
Sbjct: 242 ESYMLLAEEVINK 254


>gi|322807963|emb|CBZ05538.1| chromosome (plasmid) partitioning protein ParA / Sporulation
           initiation inhibitor protein Soj [Clostridium botulinum
           H04402 065]
          Length = 254

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/254 (47%), Positives = 184/254 (72%), Gaps = 3/254 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I+I NQKGGVGKTTT+INL + LA  G  +L ID+DPQGN ++G+G++    + S Y+
Sbjct: 2   KVISIFNQKGGVGKTTTSINLCSCLAMNGYKILNIDIDPQGNTTSGMGLDKNSLELSVYN 61

Query: 67  LLI-EEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           +L  +E +I + + Q+  I N  I+PSTM L G E+ L  + DR   L + L  ++ +DF
Sbjct: 62  VLTSDEISIKEAIKQSELISNFYILPSTMSLAGAEIELINKLDRERILLQKLK-EIENDF 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            Y+F+DCPPS  LLT+NA+AA+D +L+P+QCEF++LEG+ QL+ T+E V++++NS L+++
Sbjct: 121 DYVFIDCPPSLGLLTINALAASDGVLIPIQCEFYSLEGVGQLVNTIELVQKSLNSNLEVE 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G+IL+M+D R  L  +V  +V+K    KVY T IPRNVR++EAPS+G P I+YD KC G+
Sbjct: 181 GVILSMYDIRTRLCNEVAEEVKKYFNDKVYKTTIPRNVRLAEAPSFGLPIILYDSKCKGA 240

Query: 245 QAYLKLASELIQQE 258
           +AY  L+ E I+++
Sbjct: 241 EAYNNLSKEFIEKQ 254


>gi|261856909|ref|YP_003264192.1| cobyrinic acid ac-diamide synthase [Halothiobacillus neapolitanus
           c2]
 gi|261837378|gb|ACX97145.1| Cobyrinic acid ac-diamide synthase [Halothiobacillus neapolitanus
           c2]
          Length = 259

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 180/256 (70%), Gaps = 1/256 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S  + I NQKGGVGKTTTA+NL+ AL +IG+ VL+IDLDPQGNA+   G +     ++  
Sbjct: 2   SWTLAITNQKGGVGKTTTAVNLAAALQSIGQRVLMIDLDPQGNATVSAGQDKSVLAHTMA 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L++E +I+ ++I++      ++P+ ++L G E  L     R  +L +AL+  LT ++ 
Sbjct: 62  DVLLDEASISDVIIRSEPAGFDLLPANIELAGAEFQLVSRIGREMKLRRALAPLLT-NYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPP+ N LT+NA+ A+D +L+P+QCE+FALEGLS LLET+E+VR  +  AL + G
Sbjct: 121 FVLIDCPPALNTLTINALVASDDVLIPVQCEYFALEGLSSLLETIEQVRMALQPALGVAG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ T++D+RN L+QQV   ++ + G +++ T+IPRNVR++EAPS+G PA+ YD   AG+Q
Sbjct: 181 VLRTLYDARNLLAQQVSEQLQAHFGDQLFRTLIPRNVRLAEAPSHGLPALYYDRGSAGAQ 240

Query: 246 AYLKLASELIQQERHR 261
           AY  LA EL+ +   R
Sbjct: 241 AYTDLAHELVARAEQR 256


>gi|303234677|ref|ZP_07321305.1| sporulation initiation inhibitor protein Soj [Finegoldia magna
           BVS033A4]
 gi|302494160|gb|EFL53938.1| sporulation initiation inhibitor protein Soj [Finegoldia magna
           BVS033A4]
          Length = 248

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 176/251 (70%), Gaps = 6/251 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I + NQKGGVGKTTT +NLS AL   G+ VL++DLDPQGN ++G GI  ++ + S YD
Sbjct: 2   KTICVFNQKGGVGKTTTVVNLSAALGLKGKKVLVVDLDPQGNTTSGFGINKFELQKSIYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT--SDF 124
           L++ E      +I+T   N+ IIP+T DL G+E+ L    D+    +K LS  L+  S +
Sbjct: 62  LMVHEDFDEDFIIKTEEKNVDIIPATSDLSGVEVELINTNDK----EKVLSNILSNVSGY 117

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            + F+DCPPS   L++NA+ AA+S+L+P+QCEF+ALEG+SQL+ T+  VR ++N  L+I+
Sbjct: 118 DFCFIDCPPSLGTLSINALVAANSVLIPIQCEFYALEGVSQLMNTINLVRSSLNENLEIE 177

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           GI+++MFD RN+LS +VV +V+K    KV+ T+IPRN+R++EAPSYG  A+ YD    GS
Sbjct: 178 GIVMSMFDGRNNLSLEVVEEVKKYFKDKVFTTMIPRNIRLAEAPSYGMSALSYDKNSKGS 237

Query: 245 QAYLKLASELI 255
            AY +LA E +
Sbjct: 238 IAYKRLAEEFL 248


>gi|260063464|ref|YP_003196544.1| SpoOJ regulator protein [Robiginitalea biformata HTCC2501]
 gi|88782908|gb|EAR14082.1| SpoOJ regulator protein [Robiginitalea biformata HTCC2501]
          Length = 257

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 175/253 (69%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I IANQKGGVGKTTT +NL+ AL  + + VLLID DPQ NA++GLGI+  +    SY 
Sbjct: 3   KTIAIANQKGGVGKTTTTVNLAAALGVLEKKVLLIDADPQANATSGLGIDADNISLGSYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL   +  ++ +I T  PN+ +IP+ +DL+ IE+ L  +  R   L  AL  ++   + Y
Sbjct: 63  LLEHTRAASECIIPTNSPNVDLIPAHIDLVAIEIELVDQDRRESMLKVALE-EVRHQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DC PS  LLT+NA+ AADS+++P+QCE+FALEGL +LL T++ V+R  N  LDI+G+
Sbjct: 122 VLIDCAPSLGLLTLNALTAADSVIIPIQCEYFALEGLGKLLNTIKSVQRIHNPDLDIEGM 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D+R  LS QVV +V+K+ G  V++T+I RNVR+ EAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDARLRLSNQVVEEVKKHFGDMVFDTIIQRNVRLGEAPSYGESIIKYDASSKGAAN 241

Query: 247 YLKLASELIQQER 259
           YL +A EL+Q+ R
Sbjct: 242 YLNMAHELLQKNR 254


>gi|86160770|ref|YP_467555.1| chromosome segregation ATPase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85777281|gb|ABC84118.1| chromosome segregation ATPase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 275

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 178/251 (70%), Gaps = 2/251 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           +  RI+TIANQKGGVGKTTTA+NL+ +LAA     LL+D+DPQGNA + LGI   + + S
Sbjct: 16  RMGRILTIANQKGGVGKTTTAVNLAASLAAAEHRTLLVDVDPQGNAGSALGIRRDESEKS 75

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            Y++L++++ +++ + +T +  L ++P++  L+G E+ L     R  RL +A+   L S 
Sbjct: 76  IYEVLLDDQPLSEAVRKTELKFLDLVPASRHLVGAELELAELDARESRLKRAVDT-LASS 134

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + Y+ +DCPPS  LLT+N + AA  +++PLQCE++ALEGL+ +L+T+E VR   N  L +
Sbjct: 135 YEYVVIDCPPSLGLLTLNGLVAAQGVIIPLQCEYYALEGLADVLKTIELVRAAANPGLTV 194

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            GI+LTMF S N+L+ QV  ++RK    +V+ TVIPRNVR+SEAPS+GKP ++YD+   G
Sbjct: 195 DGIVLTMF-SPNNLANQVADEIRKTFASQVFRTVIPRNVRLSEAPSHGKPILLYDVTSKG 253

Query: 244 SQAYLKLASEL 254
            Q+YL+LA E+
Sbjct: 254 CQSYLELAREV 264


>gi|120556788|ref|YP_961139.1| cobyrinic acid a,c-diamide synthase [Marinobacter aquaeolei VT8]
 gi|120326637|gb|ABM20952.1| chromosome segregation ATPase [Marinobacter aquaeolei VT8]
          Length = 264

 Score =  249 bits (635), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/257 (45%), Positives = 175/257 (68%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +R+I + NQKGGVGKTTT +NL+ +LAA    VLL+D+DPQGNA+ G G++    + S Y
Sbjct: 2   ARVIAVTNQKGGVGKTTTCVNLAASLAATKRRVLLVDMDPQGNATMGSGVDKNSLELSGY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L +     ++++        ++P+  DL   E+ L  E  R  RL   L+  +  ++ 
Sbjct: 62  DVLTKRATPAEVIVHAEASGFDLLPANGDLTAAEVELMNEIGREHRLRLTLNT-VRENYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NA++AADS+L+P+QCE++ALEGL+ L+ TV++++ TVN  L+I+G
Sbjct: 121 YILIDCPPSLSLLTVNALSAADSVLIPMQCEYYALEGLAALMNTVQQIQETVNPNLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RNSL+  V   + +  G KVY  VIPRNVR++EAPSYG PA+ YD    G+ 
Sbjct: 181 ILRTMYDPRNSLTLDVSGQLSEYFGDKVYRAVIPRNVRLAEAPSYGMPALKYDRVSKGAV 240

Query: 246 AYLKLASELIQQERHRK 262
           AYL LA E++++   +K
Sbjct: 241 AYLALAGEMVRRHGSKK 257


>gi|58580128|ref|YP_199144.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622129|ref|YP_449501.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|58424722|gb|AAW73759.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366069|dbj|BAE67227.1| chromosome partitioning protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 265

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 182/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA + + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARVPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    QI + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAQIRV-TAPEGFDLLPGNIDLTAAEIQLMHQGEREQRLKRALT-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRGNLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++  + G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTAHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++    +A
Sbjct: 240 AYLGLAGEIVRRQNDHNKA 258


>gi|302672305|ref|YP_003832265.1| chromosome partitioning protein ParA1 [Butyrivibrio proteoclasticus
           B316]
 gi|302396778|gb|ADL35683.1| chromosome partitioning protein ParA1 [Butyrivibrio proteoclasticus
           B316]
          Length = 254

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I IANQKGGVGKTTT+INL+ ALA  G+ VL+ID DPQGN ++GLG++  +   + Y+
Sbjct: 3   RVIAIANQKGGVGKTTTSINLAAALAEKGKKVLVIDTDPQGNTTSGLGLDKNELDNTIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+I E ++   + +     L IIPS ++L  +E+ L   + + + L +++  ++  ++ +
Sbjct: 63  LMIGECDVKDAIHEEVFDKLDIIPSNVNLAAVEIELIDAEQKEYILRESIK-EIKDNYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS ++LT+NAM  A+++LVP+QCE++ALEGLSQL+ TV  V+  +N  L+++G+
Sbjct: 122 IIIDCPPSLSMLTVNAMTTANTVLVPIQCEYYALEGLSQLVHTVNLVKDRLNPELEMEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFDSR +LS QVV +V++++   VY T+IPRN+R++EAPSYG P  IY+ K AG++A
Sbjct: 182 VFTMFDSRTNLSLQVVENVKEHIQENVYKTIIPRNIRLAEAPSYGLPINIYEPKSAGAEA 241

Query: 247 YLKLASELIQQE 258
           Y  LA E+I +E
Sbjct: 242 YRLLADEVIDRE 253


>gi|325917539|ref|ZP_08179742.1| chromosome segregation ATPase [Xanthomonas vesicatoria ATCC 35937]
 gi|325536255|gb|EGD08048.1| chromosome segregation ATPase [Xanthomonas vesicatoria ATCC 35937]
          Length = 265

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    +I + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAEIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|78355078|ref|YP_386527.1| chromosome segregation ATPase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78217483|gb|ABB36832.1| chromosome segregation ATPase [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 259

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 177/257 (68%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTAINL+ +LA + + VLL+D DPQ N ++GLGI+      S Y
Sbjct: 2   ARIIAIANQKGGVGKTTTAINLAASLAVMEKRVLLVDCDPQANGTSGLGIDPDQLGESLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +    +   + +  T +  LS++P+T DL+ +E+ L  +  R + L   L   L S + 
Sbjct: 62  TVFFRPEEALEAVHPTNLEYLSVLPTTTDLVAVELELVDKMGREYYLTDVLK-NLESRYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS  L+T+NA+ AA  +L+PLQCEFFALEG+ +LL+T E+V++ +N  L + G
Sbjct: 121 YIILDCPPSLGLITLNALCAARELLIPLQCEFFALEGIVKLLQTFEQVKKRLNPGLTLMG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D RN LS+QV ++VRK     ++ TV+PRNVR+SEAPSYGK  I YD+K  G++
Sbjct: 181 VVLTMYDLRNRLSRQVKNEVRKCFPDHLFETVVPRNVRLSEAPSYGKSIIHYDVKSKGAE 240

Query: 246 AYLKLASELIQQERHRK 262
           AYL L+ E++ +   +K
Sbjct: 241 AYLALSKEVVLRRPQQK 257


>gi|116617471|ref|YP_817842.1| chromosome segregation ATPase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227432681|ref|ZP_03914654.1| chromosome partitioning protein, membrane-associated ATPase
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
 gi|116096318|gb|ABJ61469.1| chromosome segregation ATPase [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227351563|gb|EEJ41816.1| chromosome partitioning protein, membrane-associated ATPase
           [Leuconostoc mesenteroides subsp. cremoris ATCC 19254]
          Length = 253

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 180/252 (71%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT+INL  ALA  G+ VLL+D+D QGNA++G G++    ++ SY
Sbjct: 2   AQIIVLANQKGGVGKTTTSINLGAALAQAGQRVLLVDIDAQGNATSGSGVDKSLLEHDSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+++E+  ++++++ T   N  ++P+T+ L G E+ L  +  R +RL  AL   +  D+ 
Sbjct: 62  DVIVEQTPLHEVIVAT--DNYDLVPATIQLSGAEIELAKQPQREYRLKTALET-VRDDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  L+T+NA  AAD+IL+P+Q EF+ALEGL QLL T+E VR+  N  LD+ G
Sbjct: 119 FILIDNPPALGLMTVNAFTAADAILIPVQTEFYALEGLGQLLNTIELVRQQFNPDLDVAG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR     KVY+T+IPR+VR+SEAPSYG+  I +D +  G+Q
Sbjct: 179 ILLTMYDGRTNLAKQVAQEVRSYFDDKVYDTIIPRSVRLSEAPSYGQAIIDFDPRSVGAQ 238

Query: 246 AYLKLASELIQQ 257
            Y  LA E+++Q
Sbjct: 239 MYNNLAQEVLKQ 250


>gi|302877164|ref|YP_003845797.1| sporulation initiation inhibitor protein soj [Clostridium
           cellulovorans 743B]
 gi|307687863|ref|ZP_07630309.1| sporulation initiation inhibitor protein soj [Clostridium
           cellulovorans 743B]
 gi|302580021|gb|ADL54033.1| sporulation initiation inhibitor protein soj [Clostridium
           cellulovorans 743B]
          Length = 256

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 187/256 (73%), Gaps = 6/256 (2%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I++ NQKGGVGKTTT INL+  LA  G  VL+ID+DPQGN+++GLGI+    + SSY 
Sbjct: 2   KVISVFNQKGGVGKTTTNINLAAYLAVNGHKVLIIDIDPQGNSTSGLGIDKKKVEISSYH 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSD 123
           LL ++ ++ + +I++  I NL I+PST++L G  IEMI    ++++ R     + Q   +
Sbjct: 62  LLTDDISLEEAMIKSELIENLYIVPSTIELAGAEIEMIDIKNREKILREKVNKNDQ---N 118

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F ++F+DCPPS  LLT+NA++A+ S+L+P+QCE++ALEG+SQL+ T++ V++++N  L +
Sbjct: 119 FEFVFIDCPPSLGLLTLNALSASTSVLIPIQCEYYALEGVSQLVNTIQLVKKSLNKELSV 178

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G+ILTM+D+R  L  +V  +V+K  G KV+ + IPRN+R++EAPS+G P ++YD KC G
Sbjct: 179 EGVILTMYDNRTKLCNEVSVEVKKYFGDKVFESTIPRNIRLAEAPSFGLPIMLYDDKCKG 238

Query: 244 SQAYLKLASELIQQER 259
           +++Y  L  E I+++ 
Sbjct: 239 AESYEDLTKEFIKRQE 254


>gi|297588071|ref|ZP_06946715.1| sporulation initiation inhibitor protein Soj [Finegoldia magna ATCC
           53516]
 gi|297574760|gb|EFH93480.1| sporulation initiation inhibitor protein Soj [Finegoldia magna ATCC
           53516]
          Length = 254

 Score =  248 bits (634), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 173/249 (69%), Gaps = 2/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           + I + NQKGGVGKTTT +NLS AL   G+ VL++DLDPQGN ++G GI  ++ + S YD
Sbjct: 8   KTICVFNQKGGVGKTTTVVNLSAALGLKGKKVLVVDLDPQGNTTSGFGINKFELQKSMYD 67

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L++ +      +I+T   N+ IIP+T DL G+E+ L     +   L K LS    S + +
Sbjct: 68  LMVHDDFDEDFIIKTEEKNVDIIPATSDLSGVEVELINTDGKEKVLSKILSN--VSGYDF 125

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
            F+DCPPS   L++NA+ AADS+L+P+QCEF+ALEG+SQL+ T+  VR ++N  L+I+GI
Sbjct: 126 CFIDCPPSLGTLSINALVAADSVLIPIQCEFYALEGVSQLMNTINLVRSSLNENLEIEGI 185

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +++MFD RN+LS +VV +V+K    KV+ T+IPRN+R++EAPSYG  A+ YD    GS A
Sbjct: 186 VMSMFDGRNNLSLEVVEEVKKYFKDKVFTTMIPRNIRLAEAPSYGMSALSYDKNSKGSIA 245

Query: 247 YLKLASELI 255
           Y +LA E +
Sbjct: 246 YTRLAEEFL 254


>gi|253681262|ref|ZP_04862060.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           D str. 1873]
 gi|253562500|gb|EES91951.1| sporulation initiation inhibitor protein soj [Clostridium botulinum
           D str. 1873]
          Length = 261

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 118/259 (45%), Positives = 179/259 (69%), Gaps = 4/259 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I I NQKGGVGKTTT INL  +LA  G  VL ID+DPQGN ++GLGI+    KYS YD
Sbjct: 2   KVICIFNQKGGVGKTTTNINLCASLAMDGHKVLAIDIDPQGNTTSGLGIDKSKIKYSIYD 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           ++    +I   +I++  I N  ++PS M+L+G E+ L   K+R   L + +  ++   F 
Sbjct: 62  VMTSNISIEDAIIESELINNFFVVPSNMELVGAEVELIDVKERETILKRKIE-KIKDKFE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+F+DCPPS   LT+NA+ A++S+L+P+QCEF+ALEG+ QL+ T++ V++++N  L+I+G
Sbjct: 121 YVFIDCPPSLGFLTINALIASNSVLIPIQCEFYALEGVGQLINTIQLVKKSLNKDLEIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++++M+D+R  L  +V S+V K    KV+ T IPRN+R++EAPS+G P I+YD KC G++
Sbjct: 181 VLMSMYDNRTKLCNEVASEVNKYFKDKVFKTAIPRNIRLAEAPSFGLPIILYDDKCKGAE 240

Query: 246 AYLKLASELIQQERHRKEA 264
           AY  L  E ++  R  KE 
Sbjct: 241 AYKNLLGEFLK--RQEKEV 257


>gi|85861013|ref|YP_463215.1| chromosome partitioning protein [Syntrophus aciditrophicus SB]
 gi|85724104|gb|ABC79047.1| chromosome partitioning protein [Syntrophus aciditrophicus SB]
          Length = 256

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 180/254 (70%), Gaps = 2/254 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYD-RKYSSY 65
           ++I+IANQKGGVGKTTTAINLS  LA+  +  LLID D QGNAS+G+GI+    ++ + Y
Sbjct: 3   KVISIANQKGGVGKTTTAINLSATLASAEKKTLLIDCDAQGNASSGVGIQRDKCQEKNLY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
             LI    +  +++ T IP L ++ +T DL+GIE+     ++R  +L K +  +L  ++ 
Sbjct: 63  YALINRVPLRDVIMPTCIPYLDVVAATQDLVGIEVEFASLEEREKQLKKLIR-ELDREYE 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ LDCPPS   LT+NA+ A+ S++VPLQCE+FA+EGL  L+ T++ V+  +N  L + G
Sbjct: 122 FVILDCPPSLGFLTLNALVASSSVIVPLQCEYFAMEGLGHLMSTLKLVKTRLNPFLSLGG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFDSRN LS++V  DVR + G  V+NTVIPRNVR+SE+PS+G P I YD+K  G+ 
Sbjct: 182 ILLTMFDSRNLLSRRVSEDVRSHFGNHVFNTVIPRNVRLSESPSHGLPIIFYDIKSRGAV 241

Query: 246 AYLKLASELIQQER 259
           +Y++LA E++  +R
Sbjct: 242 SYMELAQEVLNCKR 255


>gi|291561692|emb|CBL40491.1| ATPases involved in chromosome partitioning [butyrate-producing
           bacterium SS3/4]
          Length = 256

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 119/253 (47%), Positives = 184/253 (72%), Gaps = 5/253 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII I NQKGGVGKTTTAINLS  LA  G+ VL +D DPQGN ++GLG+E  +   + Y+
Sbjct: 3   RIIAITNQKGGVGKTTTAINLSACLAEAGQRVLTVDFDPQGNTTSGLGLEKGNIDNTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSDF 124
           LL+ E  +++ +  +    L ++PS +DL G  IE++   EK+ + + +  L   L   +
Sbjct: 63  LLMGECTVDECINPSVQERLDVMPSDVDLAGAEIELLDMEEKESILKKNMEL---LDGKY 119

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            +I +DCPPS NLLT+NA+ AA+++LVP+QCE++ALEGLSQ+L+TV  V++ +N +L+++
Sbjct: 120 DFIIIDCPPSLNLLTINALTAANTVLVPIQCEYYALEGLSQVLKTVNLVQKKLNPSLEVE 179

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++ TM+DSR +LS +VV +V+++L   +Y T+IPRNVR++EAPSYG P  +YD + +G+
Sbjct: 180 GVVFTMYDSRTNLSLEVVENVKEHLNENIYKTIIPRNVRLAEAPSYGMPINLYDSRSSGA 239

Query: 245 QAYLKLASELIQQ 257
           ++Y  LA+E+I +
Sbjct: 240 ESYRLLAAEVISR 252


>gi|294788312|ref|ZP_06753555.1| ParA family protein [Simonsiella muelleri ATCC 29453]
 gi|294483743|gb|EFG31427.1| ParA family protein [Simonsiella muelleri ATCC 29453]
          Length = 269

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 172/249 (69%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++ITI NQKGGVGKTTTA+NL+ +LA     VLLID+DPQGNA+ G G++  + ++  Y 
Sbjct: 4   KVITICNQKGGVGKTTTAVNLAASLAHRNRKVLLIDIDPQGNATMGSGVDKNNFEFGVYH 63

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+ E +    +I +   +  +I S  DL G+E+ L     R   L  A++  +  ++ +
Sbjct: 64  LLVGEADAKTAIIHSETGHYDVISSNRDLTGVEIELMQRPAREMCLRDAIA-SVRDEYDF 122

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ +LL +N +AAADS+L+P+ CE++ALEG+S LL T++ VR+T+N  LDI G+
Sbjct: 123 ILIDCPPTLSLLMLNGLAAADSVLIPMVCEYYALEGISDLLATIKRVRQTINPTLDITGV 182

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMF ++N LSQ V + +R   G +V+NT IPRNVR++EAPS+G PA+ YD K  G+QA
Sbjct: 183 MFTMFTTQNKLSQDVSAQLRNYFGQRVFNTTIPRNVRLAEAPSHGMPALAYDPKAKGTQA 242

Query: 247 YLKLASELI 255
           YL LA E +
Sbjct: 243 YLALADEFL 251


>gi|296271537|ref|YP_003654169.1| cobyrinic acid ac-diamide synthase [Thermobispora bispora DSM
           43833]
 gi|296094324|gb|ADG90276.1| Cobyrinic acid ac-diamide synthase [Thermobispora bispora DSM
           43833]
          Length = 346

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 170/252 (67%), Gaps = 1/252 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
            K R++T+ANQKGGVGKTTTA+NL+ AL+  G+ VL+IDLDPQGNAST L  E      S
Sbjct: 86  PKCRVLTVANQKGGVGKTTTAVNLAAALSMHGQRVLVIDLDPQGNASTALATEHRSGTPS 145

Query: 64  SYDLLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
            Y +LIE+  +  I+     +PNL   P+T+DL G E+ L     R  RL +AL+     
Sbjct: 146 VYQVLIEDLPLASIVKPVPGMPNLYCAPATLDLAGAEIELVPMVGRETRLRRALNNFTGM 205

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           +  YIF+DCPPS  LLT+NA+AAA  +L+P+QCE++ALEGLSQLL+ VE VR  +N  L 
Sbjct: 206 ELDYIFIDCPPSLGLLTVNALAAAQEVLIPIQCEYYALEGLSQLLQNVELVRAHLNPPLV 265

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           +  I+LTM+D+R  L+ QV  +VR + G  V  +VIPR+VR+SEAPSY +  + YD   +
Sbjct: 266 VSTILLTMYDARTKLASQVAEEVRSHFGDTVLKSVIPRSVRVSEAPSYSQSVMTYDPGSS 325

Query: 243 GSQAYLKLASEL 254
           G+ AY+  A EL
Sbjct: 326 GAMAYMDAAREL 337


>gi|88797176|ref|ZP_01112766.1| ParA family protein [Reinekea sp. MED297]
 gi|88780045|gb|EAR11230.1| ParA family protein [Reinekea sp. MED297]
          Length = 271

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/257 (46%), Positives = 174/257 (67%), Gaps = 1/257 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S I+ I NQKGGVGKTTTAINL  +L A+   VL++D+DPQGNA+ G GI+  + + S+Y
Sbjct: 2   SHILAITNQKGGVGKTTTAINLPASLVAMKRRVLVVDMDPQGNATMGSGIDKNELEQSAY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L  + +    +I        ++P+  DL   E+ L   K +  RL  AL+ ++   + 
Sbjct: 62  DVLTGKCHCTDAIIPAPQAGYDLLPANGDLTAAEVELLDMKMKEHRLQYALA-EIKHKYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS N+LT+NA+ AA  I +P+QCE++ALEGL+ LLET+ E+++ VN AL+I G
Sbjct: 121 YIFIDCPPSLNMLTVNALTAAHHIFIPMQCEYYALEGLAALLETITEIQKVVNPALEIGG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN+L+  V   +++  G KVY  VIPRNVR++EAPSYG PA+ YD   +G++
Sbjct: 181 ILRTMYDPRNTLTNDVSDQLKEYFGDKVYAAVIPRNVRLAEAPSYGLPALHYDKSSSGAK 240

Query: 246 AYLKLASELIQQERHRK 262
           +YL LA E I++    K
Sbjct: 241 SYLALAGEFIRRSEGEK 257


>gi|331700960|ref|YP_004397919.1| Cobyrinic acid ac-diamide synthase [Lactobacillus buchneri NRRL
           B-30929]
 gi|329128303|gb|AEB72856.1| Cobyrinic acid ac-diamide synthase [Lactobacillus buchneri NRRL
           B-30929]
          Length = 254

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 177/250 (70%), Gaps = 1/250 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + +I +ANQKGGVGKTTTA+NL   +A++G+ +LL+D D QGNA++G+G+   D     Y
Sbjct: 2   TYVIALANQKGGVGKTTTAVNLGAGMASLGKKILLVDADAQGNATSGVGVSKADITKDIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+ E+ + + ++ T+   L I+P+T+ L G E+ L  +  R  RL  AL   +   + 
Sbjct: 62  DVLVNEEPMAETIVHTSHEGLDIVPATIQLSGAEIELTPQMARETRLKAALDA-VKDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ +DCPPS  L+T+NA  A+DSIL+P+Q E++ALEGLSQLL T++ V++  N  L I+G
Sbjct: 121 FVLIDCPPSLGLITINAFTASDSILIPVQSEYYALEGLSQLLNTIQLVKKHFNPNLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +L +QV ++VRK    +VY+T+IPRNVR+SEAPSYG P + YD K  G++
Sbjct: 181 VLLTMFDARTNLGEQVNTEVRKFFKDEVYDTIIPRNVRLSEAPSYGLPIMDYDPKSKGAE 240

Query: 246 AYLKLASELI 255
            Y+ LA E++
Sbjct: 241 KYMNLAKEVL 250


>gi|169335398|ref|ZP_02862591.1| hypothetical protein ANASTE_01810 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258136|gb|EDS72102.1| hypothetical protein ANASTE_01810 [Anaerofustis stercorihominis DSM
           17244]
          Length = 254

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 183/252 (72%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II++ NQKGGVGKTTTA+NLS  LA + + VL IDLDPQ N ++GL I+    +YS+Y
Sbjct: 2   TKIISLFNQKGGVGKTTTAVNLSACLAKMDKKVLGIDLDPQSNFTSGLDIDRTKLEYSTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+++ + + + ++I T + NL +IPS++DL   E+ +  +  R   L + +S  L + + 
Sbjct: 62  DIIVNDVDGSNVVINTEVENLDLIPSSIDLASAEIEIASKPKRETILKRHIS-SLIAGYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           Y+ +DC PS  LL +NA+ A++S+L+P+QCE++ALEG+SQL+ T+  V++ +N  L ++G
Sbjct: 121 YVIIDCAPSLGLLPINALCASNSVLIPIQCEYYALEGVSQLMNTINLVKKGINPYLKVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V++  G KVY T+IPRN+R++EAPS+G+  + YD    GS+
Sbjct: 181 VLLTMFDNRTNLSTQVVEEVKRFFGNKVYETIIPRNIRLAEAPSFGQTIVEYDPSSKGSK 240

Query: 246 AYLKLASELIQQ 257
           AY+ LA EL+++
Sbjct: 241 AYMNLAKELLKK 252


>gi|89897798|ref|YP_521285.1| hypothetical protein DSY5052 [Desulfitobacterium hafniense Y51]
 gi|89337246|dbj|BAE86841.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 253

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 178/252 (70%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + II IANQKGGV KTTTA+NLS  L   G+ VLL+DLDPQGNA++G G+     K S Y
Sbjct: 2   ANIIAIANQKGGVAKTTTAVNLSACLVEQGKKVLLLDLDPQGNATSGCGVIKSKLKNSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E  + +I+ QT +  L I P+ ++L G E+ L G + R  +L  AL + +  D+ 
Sbjct: 62  DVLINEVPMERIIKQTELSGLFIAPAQIELAGAEIELVGLEQREGKLASAL-MSIKGDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA  +L+P+QCE++ALEGLS L++T++ V+  +N  L+I G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAATDVLIPVQCEYYALEGLSLLMDTIQRVKGRLNPRLNILG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
            +LTMFD+R +L  QVV +V+K    KV++T++PRNVR+ EAPS+GKP ++YD +  G++
Sbjct: 181 ALLTMFDARTNLGIQVVDEVKKYFKSKVFSTIVPRNVRLGEAPSHGKPIVLYDDRSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y  LA E++Q+
Sbjct: 241 VYRDLAEEVLQR 252


>gi|325919694|ref|ZP_08181696.1| chromosome segregation ATPase [Xanthomonas gardneri ATCC 19865]
 gi|325549802|gb|EGD20654.1| chromosome segregation ATPase [Xanthomonas gardneri ATCC 19865]
          Length = 265

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    +I + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAEIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTQHFGDKVFRTIVPRNVRLAEAPSHGQSILGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|119503564|ref|ZP_01625647.1| Putative ParA family protein [marine gamma proteobacterium
           HTCC2080]
 gi|119460626|gb|EAW41718.1| Putative ParA family protein [marine gamma proteobacterium
           HTCC2080]
          Length = 256

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 114/254 (44%), Positives = 180/254 (70%), Gaps = 2/254 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ +ANQKGGVGKTTT++NL+ +LAA+G  VLL+DLDPQGNA+   G++ ++ + ++YD
Sbjct: 2   KIVAVANQKGGVGKTTTSVNLAASLAAMGRRVLLVDLDPQGNATMSSGVDKHELEATAYD 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL++++  +++++  A     ++P+  +L   E+ L   + R  RL  AL+      F  
Sbjct: 62  LLVDQRPASEVIVPAANNGYWLVPANRNLTAAEVELLDVQKRERRLADALAS--AEQFDL 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS ++LT+NA  AA S+++ +QCE+FALEGLS LL+T+  +  TVN  L+I+GI
Sbjct: 120 VLIDCPPSLSMLTVNAFVAAKSVIITMQCEYFALEGLSALLKTIRRIADTVNPTLEIEGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RNSL+ +V S + K+ G  VY TVIPRNVR++EAPS+G PA+ YD   +G++A
Sbjct: 180 LRTMYDPRNSLTGEVSSQLHKHFGDLVYRTVIPRNVRLAEAPSHGLPALHYDRYSSGARA 239

Query: 247 YLKLASELIQQERH 260
           Y  LA E +++++ 
Sbjct: 240 YAALAGEFVKKQKQ 253


>gi|295133323|ref|YP_003583999.1| ParA-like ATPase [Zunongwangia profunda SM-A87]
 gi|294981338|gb|ADF51803.1| ParA-like ATPase [Zunongwangia profunda SM-A87]
          Length = 254

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 180/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++ + +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVEEIELGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL       + ++QT+ PNL +IP+ +DL+ IE+ L  +++R   L K ++  L   + Y
Sbjct: 63  LLEHSITPEKAIMQTSSPNLDLIPAHIDLVAIEIELVDQENRESMLKKVIT-PLKELYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+++P+QCE+FALEGL +LL T++ V++  N+ LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNNKLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVQKHFDEMVFETIIQRNVRLSEAPSYGESIINYDASSKGATN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAHEIIKK 252


>gi|160946576|ref|ZP_02093779.1| hypothetical protein PEPMIC_00534 [Parvimonas micra ATCC 33270]
 gi|158446960|gb|EDP23955.1| hypothetical protein PEPMIC_00534 [Parvimonas micra ATCC 33270]
          Length = 264

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 117/259 (45%), Positives = 184/259 (71%), Gaps = 3/259 (1%)

Query: 2   EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRK 61
           ++++ R+I++ NQKGGVGKTTT +NL+ AL    + VL+ID+DPQGN+++GLG+E  D +
Sbjct: 9   KKREMRMISVFNQKGGVGKTTTVVNLAAALGFNKKKVLVIDMDPQGNSTSGLGVE--DTE 66

Query: 62  YSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
            S Y++L  EKNIN  + +T   N+ IIP+  DL G+E+ L     R + L   +  ++ 
Sbjct: 67  LSIYEVLTHEKNINDTIQKTKSKNVDIIPANSDLCGLEIELLSVDKREYLLKSEID-KIP 125

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            ++ +I +DCPPS ++L++NA+ A+ S+L+P+QCE++ALEG+SQL+ TV  +R+ +N  L
Sbjct: 126 QNYDFILVDCPPSLSILSINALVASQSVLIPIQCEYYALEGVSQLMNTVNIIRKGLNPEL 185

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           +++G++LTM+DSRN+LS  V ++       K++NTVIPRN+R++EAPS+G+  I YD   
Sbjct: 186 EVEGVLLTMYDSRNNLSYDVKNEAENYFKDKLFNTVIPRNIRLAEAPSFGESIIYYDKNS 245

Query: 242 AGSQAYLKLASELIQQERH 260
            G+ AYL LA ELI+  R 
Sbjct: 246 KGAIAYLSLAKELIKNRRK 264


>gi|86143209|ref|ZP_01061611.1| SpoOJ regulator protein [Leeuwenhoekiella blandensis MED217]
 gi|85830114|gb|EAQ48574.1| SpoOJ regulator protein [Leeuwenhoekiella blandensis MED217]
          Length = 255

 Score =  248 bits (632), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 175/251 (69%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETIEMGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL       + +++T  PNL +IP+ +DL+ IE+ L     R + + +A+   L   + Y
Sbjct: 63  LLEHSSKAEETIMKTESPNLDLIPAHIDLVAIEIELVDMDQREYMMARAIR-HLKDSYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNQKLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  LS QVV +V+K+    V++T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMFDSRLRLSNQVVDEVQKHFDEMVFDTIIQRNVRLSEAPSYGESIINYDAGSKGAAN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I +
Sbjct: 242 YLSLAQEIITK 252


>gi|110835596|ref|YP_694455.1| ParA family ATPase [Alcanivorax borkumensis SK2]
 gi|110648707|emb|CAL18183.1| ParA family ATPase [Alcanivorax borkumensis SK2]
          Length = 265

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 179/258 (69%), Gaps = 2/258 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + +  +ANQKGGVGKTT+++NL+ +LAA  + V+L+D+DPQGNA+TG G++ +D  Y+ Y
Sbjct: 2   TTVFAVANQKGGVGKTTSSVNLAASLAATRKKVMLVDIDPQGNATTGSGVDKFDTDYTIY 61

Query: 66  DLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDF 124
           D+L ++  I Q +  T       +I +  DL   E+ L     + FRL  AL+ ++   +
Sbjct: 62  DVLCDDVAIEQAVTDTPEDSGFDLIAANGDLTAAEVQLLDMSAKEFRLRNALA-RVRDQY 120

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DCPPS N+LT+NA+ AADS++VP+QCE++ALEGL+ L+ T+E++R  +N  L I 
Sbjct: 121 DYILIDCPPSLNMLTVNALTAADSVIVPIQCEYYALEGLTALMNTIEKIRMVLNPKLHIG 180

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G++ TM+D RNSLS  V + +  + G KVY T+IPRNVR++EAPS+G P I YD K  G+
Sbjct: 181 GLLRTMYDPRNSLSNDVSNQLISHFGDKVYRTIIPRNVRLAEAPSHGAPVITYDPKSRGA 240

Query: 245 QAYLKLASELIQQERHRK 262
            +YL LA E++++E+  K
Sbjct: 241 VSYLALAGEILRREQAIK 258


>gi|312876175|ref|ZP_07736162.1| Cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311796990|gb|EFR13332.1| Cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 263

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 185/252 (73%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ I NQKGGVGKTTT +NLS A++ IG+ VL ID DPQGN ++G GI+      ++Y
Sbjct: 2   ARIVAIVNQKGGVGKTTTCVNLSAAISKIGKKVLAIDCDPQGNLTSGFGIDKKSLARTTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   +  + +I+    NLSI+P+ ++L G E+ L     R FRL  A+  ++  ++ 
Sbjct: 62  DVLIGSCSAEEAIIKNKFENLSILPANVNLAGAEIELVSMIAREFRLKDAIE-KIKVEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+AAADS+++P+QCE++ALEGL+QL  T+  VR+ +N AL+I G
Sbjct: 121 YIFIDCPPSLGLLTLNALAAADSVIIPIQCEYYALEGLTQLSNTISLVRKHLNKALEIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS +VV +V++  G KV+ ++IPRNVR+SEAPS+G P IIYD +  G++
Sbjct: 181 VVLTMFDSRTNLSLEVVEEVKRFFGQKVFLSLIPRNVRLSEAPSFGLPGIIYDPESKGAK 240

Query: 246 AYLKLASELIQQ 257
           AY++LA E I +
Sbjct: 241 AYIELAEEYISR 252


>gi|219670947|ref|YP_002461382.1| cobyrinic acid ac-diamide synthase [Desulfitobacterium hafniense
           DCB-2]
 gi|219541207|gb|ACL22946.1| Cobyrinic acid ac-diamide synthase [Desulfitobacterium hafniense
           DCB-2]
          Length = 253

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 178/252 (70%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + II IANQKGGV KTTTA+NLS  L   G+ VLL+DLDPQGNA++G G+     K S Y
Sbjct: 2   ANIIAIANQKGGVAKTTTAVNLSACLVEQGKKVLLLDLDPQGNATSGCGVIKSKLKNSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E  + +I+ QT +  L I P+ ++L G E+ L G + R  +L  AL + +  D+ 
Sbjct: 62  DVLINEVPMERIIKQTELTGLFIAPAQIELAGAEIELVGLEQREGKLASAL-MSIKGDYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPPS  LLT+NA+ AA  +L+P+QCE++ALEGLS L++T++ V+  +N  L+I G
Sbjct: 121 FIIIDCPPSLGLLTLNALTAATDVLIPVQCEYYALEGLSLLMDTIQRVKGRLNPRLNILG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
            +LTMFD+R +L  QVV +V+K    KV++T++PRNVR+ EAPS+GKP ++YD +  G++
Sbjct: 181 ALLTMFDARTNLGIQVVDEVKKYFKSKVFSTIVPRNVRLGEAPSHGKPIVLYDDRSRGAE 240

Query: 246 AYLKLASELIQQ 257
            Y  LA E++Q+
Sbjct: 241 VYRDLAEEVLQR 252


>gi|315446820|ref|YP_004079699.1| chromosome segregation ATPase [Mycobacterium sp. Spyr1]
 gi|315265123|gb|ADU01865.1| chromosome segregation ATPase [Mycobacterium sp. Spyr1]
          Length = 336

 Score =  248 bits (632), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 128/253 (50%), Positives = 169/253 (66%), Gaps = 5/253 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + R+ TIANQKGGVGKTTTA+N++ ALA  G  VL+IDLDPQGNAST LGIE      SS
Sbjct: 71  RQRVFTIANQKGGVGKTTTAVNIAAALALQGLRVLVIDLDPQGNASTALGIEHRPGTPSS 130

Query: 65  YDLLIEEKNINQILIQTAIPN---LSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
           Y++LI E  +   L Q+  P+   L  IP+T+DL G E+ L     R  RL  AL+    
Sbjct: 131 YEVLIGEIGVESALQQS--PHNERLYCIPATIDLAGAEIELVSMVAREGRLRTALAELKH 188

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            DF Y+F+DCPPS  LLT+NA+ AA  +L+P+QCE++ALEG+ QLL  +E V+  +N  L
Sbjct: 189 HDFDYVFIDCPPSLGLLTINALVAAPEVLIPIQCEYYALEGVGQLLRNIEMVKAHLNPEL 248

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           D+  ++LTM D R  L+ QV +DVR++ G KV  TVIPR+V++SEAP YG   I YD   
Sbjct: 249 DVSTVVLTMHDGRTKLADQVANDVREHFGNKVLRTVIPRSVKVSEAPGYGMTIISYDPGS 308

Query: 242 AGSQAYLKLASEL 254
            G+ +YL  + EL
Sbjct: 309 RGAMSYLDASREL 321


>gi|258593686|emb|CBE70027.1| chromosome partitioning protein [NC10 bacterium 'Dutch sediment']
          Length = 252

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/249 (47%), Positives = 176/249 (70%), Gaps = 2/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTA+NL+ +LAA     LL+DLDPQGNA++ LG+E  +   ++YD
Sbjct: 2   RIIAIANQKGGVGKTTTAVNLAASLAAAEHRTLLLDLDPQGNATSALGVE-REAAPAAYD 60

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+    I  +   T  P L ++P+   L+G E+ L     R  RL +A+    T  +++
Sbjct: 61  LLMGGAKIADVARPTVAPGLDLVPAGDRLIGAEVELALSPHREARLKEAMGTG-TDAYAF 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+NA+AAA S+L+PLQCE++ALEGL++++E +   R  +N  L ++GI
Sbjct: 120 VLIDCPPSLGLLTVNALAAAHSVLIPLQCEYYALEGLARIMEAITLCRGKLNPDLQVEGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D R ++ +QV  +VR++    V  TVIPRNVR+SEAPS+GKP ++YD + +G+++
Sbjct: 180 VLTMYDMRLNICEQVEQEVRRHFPRGVLRTVIPRNVRLSEAPSFGKPVLLYDGRSSGAES 239

Query: 247 YLKLASELI 255
           YL+LA E+I
Sbjct: 240 YLRLAKEII 248


>gi|90409267|ref|ZP_01217369.1| ParA family protein [Psychromonas sp. CNPT3]
 gi|90309627|gb|EAS37810.1| ParA family protein [Psychromonas sp. CNPT3]
          Length = 263

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 179/257 (69%), Gaps = 1/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT +NL+ ++AA    VL+IDLDPQGNA+ G  I+ Y+  +++YD
Sbjct: 3   KIIAIANQKGGVGKTTTCVNLAASMAATKRKVLVIDLDPQGNATMGSNIDKYEVAHTAYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LLI++  ++Q++ +       ++ +  D+   E+ L     R  RL  AL+      + Y
Sbjct: 63  LLIDDLPLDQVIEKETSGGFHLVAANSDVTAAEVKLMSFFSRETRLRSALA-PYKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM AADS+LVP+QCE++ALEGL+ LL+T+ ++   +N+ L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMTAADSVLVPMQCEYYALEGLTALLDTITKIASVINADLKIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN LS  V   ++K+ G KVY T+IPRNVR++EAPS+G P I YD    G++A
Sbjct: 182 LRTMYDPRNRLSSDVSDQLKKHFGNKVYRTIIPRNVRLAEAPSFGTPVIYYDKYSTGAKA 241

Query: 247 YLKLASELIQQERHRKE 263
           YL LA E++++E   +E
Sbjct: 242 YLALAGEILRREEQLQE 258


>gi|255534896|ref|YP_003095267.1| ParA-like ATPase [Flavobacteriaceae bacterium 3519-10]
 gi|255341092|gb|ACU07205.1| ParA-like ATPase [Flavobacteriaceae bacterium 3519-10]
          Length = 259

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/255 (47%), Positives = 180/255 (70%), Gaps = 3/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTTA+NL+ AL  + + +LLID DPQ NA++GLGI+  +  +S+Y
Sbjct: 2   AKIIGVANQKGGVGKTTTAVNLAAALGVLEKKILLIDADPQANATSGLGID--EANFSTY 59

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +LL    +  + + +TA PNL IIPS +DL+  E+ L   ++R + L  AL   +  D+ 
Sbjct: 60  NLLEHSADARKCVQKTASPNLDIIPSHIDLVAAEIELVDRENREYMLRSALK-DIREDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DC PS  L+T+NA+ AADS+++P+QCE+FALEGL +LL T++ V++  N  LDI+G
Sbjct: 119 YIIIDCAPSLGLITINALTAADSVIIPIQCEYFALEGLGKLLNTIKNVQKIHNKDLDIEG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+DSR  LS QVV +V  +    V+ T+I RNVR+SEAPS+G+  + YD +  G+ 
Sbjct: 179 LLLTMYDSRLRLSNQVVEEVNSHFPEMVFETIISRNVRLSEAPSFGESILNYDAESKGAI 238

Query: 246 AYLKLASELIQQERH 260
            YL+LA E++ +  H
Sbjct: 239 QYLQLAEEVLLKNDH 253


>gi|257095885|ref|YP_003169526.1| cobyrinic acid ac-diamide synthase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048409|gb|ACV37597.1| Cobyrinic acid ac-diamide synthase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 274

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 176/252 (69%), Gaps = 2/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ + NQKGGVGKTTTA+NLS  LA +G+ VLLIDLDPQGNA+TG G+       + Y
Sbjct: 7   AKILAVTNQKGGVGKTTTAVNLSACLAELGQRVLLIDLDPQGNATTGCGVVKRVALPTVY 66

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI    I    + T      ++P+  +L G E+ L     R +RL  AL V L  ++ 
Sbjct: 67  QILIGRSTIADTRLVTEF-GFDVLPANRELAGAEIDLIDIAQREYRLRDAL-VGLRGEYD 124

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ LDCPP+ N+LT+N + AAD++++P+QCE++ALEGL+ L+ T+++VR  +N  L+I+G
Sbjct: 125 FVLLDCPPALNMLTVNGLVAADAVMIPMQCEYYALEGLTDLVATLKKVRGNLNPVLEIEG 184

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD R++L+QQV  ++  + G KVY T+IPRNVR++EAPSYGKP I +D    G+Q
Sbjct: 185 LLRTMFDPRSTLTQQVSRELEGHFGAKVYRTIIPRNVRLAEAPSYGKPVIAFDRSSKGAQ 244

Query: 246 AYLKLASELIQQ 257
           AYL LA E++++
Sbjct: 245 AYLLLAEEILER 256


>gi|218960616|ref|YP_001740391.1| soj protein [Candidatus Cloacamonas acidaminovorans]
 gi|167729273|emb|CAO80184.1| soj protein [Candidatus Cloacamonas acidaminovorans]
          Length = 254

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 174/251 (69%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++IT+ NQKGGVGKTTTA+NLS  LA + +  LLID DPQGNA++G+GI+    +   YD
Sbjct: 3   KVITVVNQKGGVGKTTTAVNLSAGLAVLEKRTLLIDFDPQGNATSGVGIDKDKVELQIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI    I + ++ TA  NL  IP  ++L G E+ L  E  R  +L +AL   L S F Y
Sbjct: 63  ALIGRAPIEKTILSTATKNLFCIPGNINLTGAEIELVHEFAREQKLKEALQPILNS-FDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  LLT+NAM AA  +L+P+QCE++ALEG+SQLL T+  +++ +N  L+I G+
Sbjct: 122 IIIDCPPSLGLLTVNAMTAAMEVLIPIQCEYYALEGVSQLLTTIRLIQKNLNPGLNILGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R +LS QV  +V +    KV+ T+IPRN++++EAP +GKP  +YD++  G+ +
Sbjct: 182 LLTMFDKRVNLSLQVAKEVHRYFKEKVFRTIIPRNIKLTEAPGFGKPIFLYDIRSPGAMS 241

Query: 247 YLKLASELIQQ 257
           YL LA+E+I +
Sbjct: 242 YLNLANEVINR 252


>gi|269793315|ref|YP_003318219.1| Cobyrinic acid ac-diamide synthase [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100950|gb|ACZ19937.1| Cobyrinic acid ac-diamide synthase [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 256

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 175/250 (70%), Gaps = 2/250 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           ++ + NQKGGVGKT++ +NLS ALA  G+ VLL+D+DPQGNA++GLGI+      S Y+L
Sbjct: 3   VLAMTNQKGGVGKTSSCVNLSAALALKGKRVLLVDMDPQGNATSGLGIDRGALSSSVYEL 62

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           L+ +   +Q+ +   + NL ++P+T+DL G E+ L     R  RL K        ++  +
Sbjct: 63  LLGDAQFDQVAVPCDVENLWVLPATIDLAGAEIELSSAISRESRLRKFRD--RFQEYDLV 120

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
           F+DCPPS  LLT+NA+ AAD  +VP+QCE++ALEGLSQLL+T++ VR+ +N ++D+ GII
Sbjct: 121 FIDCPPSLGLLTLNALVAADKFVVPIQCEYYALEGLSQLLKTIDLVRQYLNPSIDLFGII 180

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTM+D+R  LS+ V   VR+    + + T+IPRNVR+SE+PSYG P + YD    G+QAY
Sbjct: 181 LTMYDNRTRLSRDVAEQVRQGFPRETFETMIPRNVRVSESPSYGMPVVTYDPSSQGAQAY 240

Query: 248 LKLASELIQQ 257
           ++LA E++ +
Sbjct: 241 MELAKEVLSR 250


>gi|332297032|ref|YP_004438954.1| Cobyrinic acid ac-diamide synthase [Treponema brennaborense DSM
           12168]
 gi|332180135|gb|AEE15823.1| Cobyrinic acid ac-diamide synthase [Treponema brennaborense DSM
           12168]
          Length = 251

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 174/251 (69%), Gaps = 3/251 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++    NQKGGVGKTT+ INL   LA  G+ VLL+D D QGN ++G+GI     K + Y+
Sbjct: 3   KVFVFVNQKGGVGKTTSVINLGAYLAEAGKKVLLVDFDSQGNMTSGVGIS--KEKPTIYE 60

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           L+ E     Q++ ++ +  + +IP+++DL G  + L G+ DR F L  AL   L S + Y
Sbjct: 61  LMAELATPQQVIKRSDVEGMDVIPASIDLSGASIELVGQADREFYLKNALK-PLVSQYDY 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+N +AAAD++L+P+QCE+FALEG++ LL+TV++V++++N AL I GI
Sbjct: 120 ILIDCPPSLGILTLNGLAAADAVLIPMQCEYFALEGITLLLQTVKKVQKSINPALGIGGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
             TM+DSR  L+Q VV+ V+   G  V++T+IPRNVR+SEAPS+G P   YD  C G+++
Sbjct: 180 FFTMYDSRTRLAQDVVTQVKSYFGDAVFSTIIPRNVRLSEAPSHGLPICKYDPSCTGARS 239

Query: 247 YLKLASELIQQ 257
           Y  LA E+I++
Sbjct: 240 YKNLAEEVIKR 250


>gi|314929159|gb|EFS92990.1| putative partitioning protein ParA [Propionibacterium acnes
           HL044PA1]
          Length = 330

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 173/259 (66%), Gaps = 4/259 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K    I +ANQKGGVGKTTTAIN + ALA  G  VL+ID DPQGNAST LGI+       
Sbjct: 51  KTPMTIVVANQKGGVGKTTTAINFAVALAMSGLRVLVIDADPQGNASTALGIDHEAGTPG 110

Query: 64  SYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL-T 121
           +Y++L++E++I  +  Q+   P L ++P+T+DL G E+ L   K R  RL KAL   L T
Sbjct: 111 TYEVLLDEEDIGLVAKQSPETPGLEVVPATIDLSGAELQLVDVKGRERRLRKALHKYLKT 170

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D  Y+ LDCPPS  LLT+NA+ AAD +L+P+QCE++ALEG++QL+ TVE VR  +N  L
Sbjct: 171 HDVDYVILDCPPSLGLLTLNALVAADEVLLPIQCEYYALEGVTQLMRTVEAVRHAMNKEL 230

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            +  I++TMFD+R  LS QV  +VR +   +   T IPR+VRISEAPSY +  + Y+ K 
Sbjct: 231 RLGSILMTMFDARTRLSTQVDEEVRTHFARETMTTRIPRSVRISEAPSYSRSVLTYEPKS 290

Query: 242 AGSQAYLKLASELIQQERH 260
           AG+ AY + A+E  +  RH
Sbjct: 291 AGAIAYREAAAEFAK--RH 307


>gi|241888631|ref|ZP_04775938.1| sporulation initiation inhibitor protein Soj [Gemella haemolysans
           ATCC 10379]
 gi|241864654|gb|EER69029.1| sporulation initiation inhibitor protein Soj [Gemella haemolysans
           ATCC 10379]
          Length = 253

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ I NQKGGVGKTTT+INL+ +LA + + VLLID DPQ NA++G+G++      S Y+
Sbjct: 3   KILAICNQKGGVGKTTTSINLAASLAHLKKKVLLIDTDPQANATSGVGVDKAAISQSIYN 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L++E NIN ++I+TA  NL I+PS++ L G E+ L     R  R+  A+S ++  ++ Y
Sbjct: 63  ILVDEVNINDVIIKTAYENLDIVPSSIALAGAEVELVSAISREQRMKNAIS-EIKDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  L+T+N++ AAD +++P+Q E++ALEGLSQL+ T   VR+ +NS LDI G+
Sbjct: 122 VVIDCPPSLGLITLNSLTAADGVIIPVQTEYYALEGLSQLMNTFNIVRKHLNSKLDIFGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM DSR ++S QV   VR++   K + TVI R VR+SEAPS+G+P I Y     G++ 
Sbjct: 182 LLTMTDSRTNISNQVAEQVREHFKDKAFETVIARTVRLSEAPSFGEPIIEYAKNSNGAKQ 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAKEVIER 252


>gi|255527655|ref|ZP_05394514.1| Cobyrinic acid ac-diamide synthase [Clostridium carboxidivorans P7]
 gi|296186794|ref|ZP_06855195.1| sporulation initiation inhibitor protein Soj [Clostridium
           carboxidivorans P7]
 gi|255508635|gb|EET85016.1| Cobyrinic acid ac-diamide synthase [Clostridium carboxidivorans P7]
 gi|296048508|gb|EFG87941.1| sporulation initiation inhibitor protein Soj [Clostridium
           carboxidivorans P7]
          Length = 255

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/255 (45%), Positives = 182/255 (71%), Gaps = 2/255 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II+I NQKGGVGKTTTAINLS  LA  G  +L ID+DPQGN ++GLG +      S YD
Sbjct: 2   KIISIFNQKGGVGKTTTAINLSAYLAMQGYKILNIDIDPQGNTTSGLGFDKRTINESIYD 61

Query: 67  LLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           +L  + ++++++ +   + N  IIPSTM+L G E+ L  + +R   L + +  QL   F 
Sbjct: 62  VLTSDVSLDEVMKKCELVDNFYIIPSTMELAGAEVELIDKPNRENILKEKIK-QLNEKFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +IF+DCPPS  LLT+NA+  ++S+L+P+QCEF+ALEG+ QL+ T++ V++++N  ++++G
Sbjct: 121 FIFIDCPPSLGLLTINALTLSNSVLIPIQCEFYALEGVGQLVNTIQLVKKSLNKNIEVEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +I++M+D R  LS +VV++VRK    KVY+  IPRN+R++EAPS+G P ++YD KC G++
Sbjct: 181 VIMSMYDGRTKLSNEVVNEVRKYFKDKVYDVTIPRNIRLAEAPSFGLPIMLYDDKCRGAE 240

Query: 246 AYLKLASELIQQERH 260
           AY  L  E +++++ 
Sbjct: 241 AYENLTKEFLKRQKE 255


>gi|307720690|ref|YP_003891830.1| chromosome segregation ATPase [Sulfurimonas autotrophica DSM 16294]
 gi|306978783|gb|ADN08818.1| chromosome segregation ATPase [Sulfurimonas autotrophica DSM 16294]
          Length = 260

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 183/260 (70%), Gaps = 10/260 (3%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S +I IANQKGGVGKTTTA+NL+ +LA   + VLLID DPQ NA+T LG    D +++ Y
Sbjct: 2   SEVIVIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDSDPQANATTSLGFHRNDYEFNIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIE---MILGGEKDRLFRLDKALSVQLTS 122
            +LI  K +  I++++ +P L + PS + L+GIE         K R   L KA++  +  
Sbjct: 62  HVLIGTKKLKDIILKSDLPTLHLAPSNIGLVGIEKEYYDADKAKGRELVLKKAIA-NIQK 120

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           D+ YI +D PP+   +T+NA++AA+S+++P+QCEFFALEGL+QLL TV+ VR+++N  L 
Sbjct: 121 DYDYIIIDSPPALGPMTINALSAANSVIIPIQCEFFALEGLAQLLNTVKLVRKSINPKLA 180

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN------TVIPRNVRISEAPSYGKPAII 236
           ++G + TMF S+N+LS+QV +D+R++  GK++        V+PRNV+++E+PS+GKPAI+
Sbjct: 181 VKGFLPTMFSSQNNLSKQVFADLRQHFKGKLFKDETDKYIVVPRNVKLAESPSFGKPAIL 240

Query: 237 YDLKCAGSQAYLKLASELIQ 256
           YD+K +GS AY  LA  +I+
Sbjct: 241 YDVKSSGSIAYQNLAQAIIK 260


>gi|213963870|ref|ZP_03392117.1| SpoOJ regulator protein [Capnocytophaga sputigena Capno]
 gi|213953460|gb|EEB64795.1| SpoOJ regulator protein [Capnocytophaga sputigena Capno]
          Length = 256

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI++   ++ +Y+
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGIDVDSIEHGTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL        +++ T  PNL +I + ++L+ IE+ L  ++ R F L KAL   +  ++ Y
Sbjct: 63  LLEHTMEAKDMIVHTTSPNLDLIAAHINLVAIEIELVDKEQREFMLKKALE-SIKDEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+NA+ AA+S++VP+QCE+FALEGL +LL T++ V++T N  LDI+G+
Sbjct: 122 ILIDCAPSLGLITLNALTAANSVIVPIQCEYFALEGLGKLLNTIKSVQKTFNPDLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D+R  LS QVV +V+K+    V+ T+I RNVR+SEAPS+G+  I YD    G+  
Sbjct: 182 LLTMYDARLRLSNQVVEEVQKHFSDMVFKTIIQRNVRLSEAPSFGETIINYDATSKGATN 241

Query: 247 YLKLASELIQQER 259
           ++ LA E+I + +
Sbjct: 242 HINLAQEIIDKNK 254


>gi|21233272|ref|NP_639189.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66770230|ref|YP_244992.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|21115109|gb|AAM43080.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575562|gb|AAY50972.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 265

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  +   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKREVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    +I + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAEIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|330718086|ref|ZP_08312686.1| chromosome segregation ATPase [Leuconostoc fallax KCTC 3537]
          Length = 255

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 180/252 (71%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +ANQKGGVGKTTT+INL  ALA  G+ VLL+D+D QGNA++GLG++  + ++  Y
Sbjct: 3   NQIIALANQKGGVGKTTTSINLGAALAQAGKRVLLVDIDAQGNATSGLGVDKSEVEHDIY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+++++  I + +I T   N  ++PST+ L G E+ L  +  R  RL +AL+  +  ++ 
Sbjct: 63  DVIVDQLPIQEAIIAT--DNYDLVPSTIQLSGAEIELANQDAREDRLKQALNT-VRDNYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +D PP+  LLT+NA  AAD++L+P+Q EF+ALEGL QLL T+E VR+  N  LD+ G
Sbjct: 120 FILIDNPPALGLLTVNAFTAADAVLIPVQTEFYALEGLGQLLNTIELVRQQFNPELDVAG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +L++QV  +VR     KVY+T+IPRNVR+SEAPSYG+  I +D +  G++
Sbjct: 180 ILLTMYDGRTNLAKQVAQEVRSYFSDKVYDTMIPRNVRLSEAPSYGQAIIDFDPRSVGAK 239

Query: 246 AYLKLASELIQQ 257
            Y +LA E+I Q
Sbjct: 240 VYTQLAQEVIAQ 251


>gi|89890951|ref|ZP_01202460.1| chromosome partitioning protein parA, CbiA family [Flavobacteria
           bacterium BBFL7]
 gi|89517096|gb|EAS19754.1| chromosome partitioning protein parA, CbiA family [Flavobacteria
           bacterium BBFL7]
          Length = 256

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 177/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTTA+NL+ +L  + + VLLID DPQ NA++GLGI++   +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTAVNLAASLGVLEKKVLLIDADPQANATSGLGIDVETVENGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL       +++++T  PNL IIP+ +DL+ IE+ L  +  R + + +A+   L   + Y
Sbjct: 63  LLEHTVPALELVVKTESPNLDIIPAHIDLVAIEIELVDKDQREYMMSEAVQ-PLKDVYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A++S+L+P+QCE+FALEGL +LL T++ +++  N  LDI+G+
Sbjct: 122 IIIDCAPSLGLLTLNALTASNSVLIPIQCEYFALEGLGKLLNTIKSIQKIHNDQLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V K+     + T+I RNVR+SEAPSYG+  I YD    GS+ 
Sbjct: 182 LLTMYDSRLRLSNQVVEEVNKHFKALTFKTIIQRNVRLSEAPSYGESIINYDASSKGSEN 241

Query: 247 YLKLASELIQQ 257
           YL LA+ELIQ+
Sbjct: 242 YLSLANELIQK 252


>gi|188993428|ref|YP_001905438.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167735188|emb|CAP53400.1| chromosome partitioning protein [Xanthomonas campestris pv.
           campestris]
          Length = 265

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 183/259 (70%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  +   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKREVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    +I + TA     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAEIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N AL+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPALEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|86743216|ref|YP_483616.1| chromosome segregation ATPase [Frankia sp. CcI3]
 gi|86570078|gb|ABD13887.1| chromosome segregation ATPase [Frankia sp. CcI3]
          Length = 330

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/262 (47%), Positives = 181/262 (69%), Gaps = 2/262 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + RII++ANQKGGVGKTTT +NL+ ALA+ G  VL+IDLDPQGNAST LG+  +    S 
Sbjct: 70  RRRIISVANQKGGVGKTTTTVNLAAALASHGSRVLVIDLDPQGNASTALGVNHHSGVPSI 129

Query: 65  YDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           Y++L+ ++ ++++++++A    L   P+T+DL G E+ L     R  RL +A++  +  D
Sbjct: 130 YEVLVGDRPLDEVIVKSAEASGLFCAPATIDLAGAEIELVSLVARENRLRRAIA-SMQRD 188

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
             Y+F+DCPPS  LLT+NA+ AA  +L+P+QCE++ALEGL  LL  VE V+  +N  L +
Sbjct: 189 VDYVFIDCPPSLGLLTVNALVAARELLIPIQCEYYALEGLGMLLRNVELVQAHLNQELRL 248

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
             I+LTM+DSR  L+ QVV +V+++ G +V +T IPRNVR++EAPSYG+ A+ YD    G
Sbjct: 249 STILLTMYDSRTRLADQVVHEVKEHFGDRVLSTTIPRNVRLAEAPSYGQSALTYDPTSRG 308

Query: 244 SQAYLKLASELIQQERHRKEAA 265
           S +YL  A EL ++ R    AA
Sbjct: 309 SLSYLAAARELAERGRDSNGAA 330


>gi|328905776|gb|EGG25552.1| putative chromosome partitioning protein ParA [Propionibacterium
           sp. P08]
          Length = 328

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 173/259 (66%), Gaps = 4/259 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K    I +ANQKGGVGKTTTAIN + ALA  G  VL+ID DPQGNAST LGI+       
Sbjct: 49  KTPMTIVVANQKGGVGKTTTAINFAVALAMSGLRVLVIDADPQGNASTALGIDHEAGTPG 108

Query: 64  SYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL-T 121
           +Y++L++E++I  +  Q+   P L ++P+T+DL G E+ L   K R  RL KAL   L T
Sbjct: 109 TYEVLLDEEDIGLVAKQSPETPGLEVVPATIDLSGAELQLVDVKGRERRLRKALRKYLKT 168

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D  Y+ LDCPPS  LLT+NA+ AAD +L+P+QCE++ALEG++QL+ TVE VR  +N  L
Sbjct: 169 HDVDYVILDCPPSLGLLTLNALVAADEVLLPIQCEYYALEGVTQLMRTVEAVRHAMNKEL 228

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            +  I++TMFD+R  LS QV  +VR +   +   T IPR+VRISEAPSY +  + Y+ K 
Sbjct: 229 RLGSILMTMFDARTRLSTQVDEEVRTHFARETMTTRIPRSVRISEAPSYSRSVLTYEPKS 288

Query: 242 AGSQAYLKLASELIQQERH 260
           AG+ AY + A+E  +  RH
Sbjct: 289 AGAIAYREAAAEFAK--RH 305


>gi|312794732|ref|YP_004027655.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181872|gb|ADQ42042.1| cobyrinic acid ac-diamide synthase [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 263

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 127/252 (50%), Positives = 185/252 (73%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RI+ I NQKGGVGKTTT +NLS A++ IG+ VL ID DPQGN ++G GI+      ++Y
Sbjct: 2   TRIVAIVNQKGGVGKTTTCVNLSAAISKIGKKVLAIDCDPQGNLTSGFGIDKKSLVRTTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI   +  + +I+    NLSI+P+ ++L G E+ L     R FRL  A+  ++  ++ 
Sbjct: 62  DVLIGSCSAEEAIIKNKFENLSILPANVNLAGAEIELVSMIAREFRLKDAIE-KIKVEYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS  LLT+NA+AAADS+++P+QCE++ALEGL+QL  T+  VR+ +N AL+I G
Sbjct: 121 YIFIDCPPSLGLLTLNALAAADSVIIPIQCEYYALEGLTQLSNTISLVRKHLNKALEIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFDSR +LS +VV +V++  G KV+ ++IPRNVR+SEAPS+G P IIYD +  G++
Sbjct: 181 VVLTMFDSRTNLSLEVVEEVKRFFGQKVFLSLIPRNVRLSEAPSFGLPGIIYDPESKGAK 240

Query: 246 AYLKLASELIQQ 257
           AY++LA E I +
Sbjct: 241 AYIELAEEYISR 252


>gi|251772736|gb|EES53298.1| Cobyrinic acid a,c-diamide synthase [Leptospirillum
           ferrodiazotrophum]
          Length = 256

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 176/252 (69%), Gaps = 2/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I+ IANQKGGVGKTTT INL+ +LA     VL+IDLDPQ N S+GLG+       SSY
Sbjct: 2   AQIVAIANQKGGVGKTTTTINLAASLAVEERKVLVIDLDPQSNTSSGLGLTAGLPPCSSY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIE--MILGGEKDRLFRLDKALSVQLTSD 123
           +LL  +K + ++L +TA+P L  IP ++ + G E  +      +R   L + L+   TS 
Sbjct: 62  ELLSGKKAMAEVLKKTALPFLDAIPCSVAMAGFEPEVAAADPNERANILKERLTQPETSG 121

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + YI LDCPPS   +T+NA+ AA+S+L+P+QCEFFALEGL QL++T+E VR+  N  L I
Sbjct: 122 YDYIILDCPPSLGFITLNALVAANSVLIPVQCEFFALEGLGQLVKTMERVRQRWNPGLKI 181

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +GI+ TM+D RN LS  V+ +++K+   +V++ VIPRNV + EAPS+GKPA++YD+   G
Sbjct: 182 EGILPTMYDKRNKLSTSVLEELKKHFPDEVFSCVIPRNVTLGEAPSHGKPAVLYDVLSKG 241

Query: 244 SQAYLKLASELI 255
           +Q+Y+ LA E++
Sbjct: 242 AQSYMTLAKEIL 253


>gi|313835187|gb|EFS72901.1| putative partitioning protein ParA [Propionibacterium acnes
           HL037PA2]
 gi|314970891|gb|EFT14989.1| putative partitioning protein ParA [Propionibacterium acnes
           HL037PA3]
          Length = 330

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 173/259 (66%), Gaps = 4/259 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           K    I +ANQKGGVGKTTTAIN + ALA  G  VL+ID DPQGNAST LGI+       
Sbjct: 51  KTPMTIVVANQKGGVGKTTTAINFAVALAMSGLRVLVIDADPQGNASTALGIDHEAGTPG 110

Query: 64  SYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL-T 121
           +Y++L++E++I  +  Q+   P L ++P+T+DL G E+ L   K R  RL KAL   L T
Sbjct: 111 TYEVLLDEEDIGLVAKQSPETPGLEVVPATIDLSGAELQLVDVKGRERRLRKALRKYLKT 170

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            D  Y+ LDCPPS  LLT+NA+ AAD +L+P+QCE++ALEG++QL+ TVE VR  +N  L
Sbjct: 171 HDVDYVILDCPPSLGLLTLNALVAADEVLLPIQCEYYALEGVTQLMRTVEAVRHAMNKEL 230

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
            +  I++TMFD+R  LS QV  +VR +   +   T IPR+VRISEAPSY +  + Y+ K 
Sbjct: 231 RLGSILMTMFDARTRLSTQVDEEVRTHFARETMTTRIPRSVRISEAPSYSRSVLTYEPKS 290

Query: 242 AGSQAYLKLASELIQQERH 260
           AG+ AY + A+E  +  RH
Sbjct: 291 AGAIAYREAAAEFAK--RH 307


>gi|78049574|ref|YP_365749.1| chromosome partitioning protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325924901|ref|ZP_08186333.1| chromosome segregation ATPase [Xanthomonas perforans 91-118]
 gi|325926172|ref|ZP_08187531.1| chromosome segregation ATPase [Xanthomonas perforans 91-118]
 gi|78038004|emb|CAJ25749.1| chromosome partitioning protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325543419|gb|EGD14843.1| chromosome segregation ATPase [Xanthomonas perforans 91-118]
 gi|325544688|gb|EGD16039.1| chromosome segregation ATPase [Xanthomonas perforans 91-118]
          Length = 265

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 181/259 (69%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    QI +  A     ++P  +DL   E+ L  + +R  RL +AL+  +  ++ 
Sbjct: 62  DLLLGENTAAQIRV-AAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRDEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N  L+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPTLEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKEA 264
           AYL LA E+++++  R +A
Sbjct: 240 AYLGLAGEIVRRQNDRNKA 258


>gi|187251945|ref|YP_001876427.1| chromosome partitioning ATPase [Elusimicrobium minutum Pei191]
 gi|186972105|gb|ACC99090.1| ATPases involved in chromosome partitioning [Elusimicrobium minutum
           Pei191]
          Length = 274

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 178/252 (70%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + I++IANQKGGVGKTTT+INL+ ALA +G+ VLL+D DPQGNAS+G+GI L D + S Y
Sbjct: 2   AEIVSIANQKGGVGKTTTSINLAYALATLGQEVLLVDFDPQGNASSGIGINLKDGEKSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            LL +   + ++L +T+   L I+P+  DL G E+ L   + R   L +AL+  L + + 
Sbjct: 62  HLLTKTAKVEEVLKRTSNEMLDILPACKDLAGAEVELVNIEGRENMLTQALA-PLQNMYK 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS +LLT+NAM A++S++ P+QCE++A+EGL+  + T  ++++ +N  L+I G
Sbjct: 121 YIIIDCPPSLSLLTLNAMVASNSVITPIQCEYYAMEGLAHFINTASKIKQVLNPKLNIDG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
            +LTM+DSR +LS QV+ ++ K  G +VY T IPRN+R++EAPS+G+    YD  C G+ 
Sbjct: 181 GLLTMYDSRMNLSNQVLEEINKFYGDRVYKTPIPRNIRLAEAPSFGQSIFDYDPACRGAA 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E + +
Sbjct: 241 AYLDLAKEFLTR 252


>gi|197124871|ref|YP_002136822.1| cobyrinic acid ac-diamide synthase [Anaeromyxobacter sp. K]
 gi|220919589|ref|YP_002494893.1| Cobyrinic acid ac-diamide synthase [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|196174720|gb|ACG75693.1| Cobyrinic acid ac-diamide synthase [Anaeromyxobacter sp. K]
 gi|219957443|gb|ACL67827.1| Cobyrinic acid ac-diamide synthase [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 259

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 176/248 (70%), Gaps = 2/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+TIANQKGGVGKTTTA+NL+ +LAA     LL+D+DPQGNA + LGI   + + S Y+
Sbjct: 3   RILTIANQKGGVGKTTTAVNLAASLAAAEHRTLLVDVDPQGNAGSALGIRRDESEKSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L++++ +++ + +T +  L ++P++  L+G E+ L     R  RL +A+   L   + Y
Sbjct: 63  VLLDDQPLSEAVRKTELKFLDLVPASRHLVGAELELAELDARESRLKRAVDT-LAPSYEY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS  LLT+N + AA  +++PLQCE++ALEGL+ +L+T+E VR   N  L + GI
Sbjct: 122 VVIDCPPSLGLLTLNGLVAAQGVIIPLQCEYYALEGLADVLKTIELVRAAANPGLTVDGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMF S N+L+ QV  ++RK    +V+ TVIPRNVR+SEAPS+GKP ++YD+   G Q+
Sbjct: 182 VLTMF-SPNNLANQVADEIRKTFASQVFQTVIPRNVRLSEAPSHGKPILLYDVTSKGCQS 240

Query: 247 YLKLASEL 254
           YL+LA E+
Sbjct: 241 YLELAREV 248


>gi|309811437|ref|ZP_07705224.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Dermacoccus
           sp. Ellin185]
 gi|308434744|gb|EFP58589.1| CobQ/CobB/MinD/ParA nucleotide binding domain protein [Dermacoccus
           sp. Ellin185]
          Length = 582

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/256 (47%), Positives = 172/256 (67%), Gaps = 6/256 (2%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
             R++T+ANQKGGVGKTTT +N++ ALA  G  VL+ID+DPQGNAST LGIE +    S 
Sbjct: 311 HPRVLTVANQKGGVGKTTTTVNVAAALAQAGLKVLVIDIDPQGNASTALGIEHHSDVPSV 370

Query: 65  YDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL--- 120
           YD+++E   I++++ Q   IP L   P+T+DL G E+ L     R  RL +A++ QL   
Sbjct: 371 YDVIVEGTPIDEVMAQCPDIPGLWCAPATIDLAGAEIELVSLVARESRLHRAINAQLADS 430

Query: 121 TSD--FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVN 178
           T D  F Y+F+DCPPS  LLT+NA  AAD + +P+QCE++ALEGLSQLL+ +E ++  +N
Sbjct: 431 TPDERFDYVFIDCPPSLGLLTVNAFVAADEVFIPIQCEYYALEGLSQLLKNIEMIKMHLN 490

Query: 179 SALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYD 238
             L +  I+LTM+D R +LS QV  +VR +   +V   ++PR+VRISEAPS+G+  + YD
Sbjct: 491 PGLHVSTILLTMYDGRTNLSAQVADEVRAHFPEQVLGALVPRSVRISEAPSHGETVMTYD 550

Query: 239 LKCAGSQAYLKLASEL 254
               G+ +Y   A E+
Sbjct: 551 PTSTGATSYRDAAREI 566


>gi|239904652|ref|YP_002951390.1| chromosome partitioning protein ParA [Desulfovibrio magneticus
           RS-1]
 gi|239794515|dbj|BAH73504.1| chromosome partitioning protein ParA [Desulfovibrio magneticus
           RS-1]
          Length = 256

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 119/255 (46%), Positives = 179/255 (70%), Gaps = 5/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS- 64
           +R+I IANQKGGVGKTTTA+NL+ +LA + + VLLID DPQ NAS+GL I  Y  + S  
Sbjct: 2   ARVIVIANQKGGVGKTTTAVNLAASLAVMEKKVLLIDCDPQANASSGLSI--YQDQISEN 59

Query: 65  -YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            Y +L + +N  +  + T +P L+++PS  DL+  ++ L  +  R F + + L   +  +
Sbjct: 60  LYSVLFDPENARKAFVGTELPFLTVLPSAPDLVAADIELVDKPGREFYMRR-LVEAVQDE 118

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F YI LDCPPS  L+T+NA+ AA  +LVPLQCE++ALEG++QLL T ++VR+ +N  L +
Sbjct: 119 FDYILLDCPPSLGLVTLNALCAATEMLVPLQCEYYALEGIAQLLRTYDQVRKRLNPRLRL 178

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            G++LTM+D RN L++ V  +V K      + T+IPRN+R+SEAPSYGKPA+ +D+K  G
Sbjct: 179 LGVVLTMYDGRNKLNRHVKREVWKCFPKLYFQTLIPRNIRLSEAPSYGKPALTHDVKSRG 238

Query: 244 SQAYLKLASELIQQE 258
           ++AY+ LA E+++++
Sbjct: 239 AEAYISLAQEVVRRQ 253


>gi|158521642|ref|YP_001529512.1| cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3]
 gi|158510468|gb|ABW67435.1| Cobyrinic acid ac-diamide synthase [Desulfococcus oleovorans Hxd3]
          Length = 263

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 182/256 (71%), Gaps = 5/256 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S+ I IANQKGGVGKTTT++NL+ ALA++   VLL+D DPQ NA+TG+G++    + + Y
Sbjct: 10  SQTICIANQKGGVGKTTTSVNLAAALASLARKVLLVDCDPQANATTGVGVDKAGLEKTLY 69

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSD 123
            +LI +    + +IQT + NLSI+PS ++L G  +EM+    K++L     A+   + +D
Sbjct: 70  HVLIGDTPAARAVIQTPVKNLSILPSRVELSGFEVEMVDEPGKEKLL---AAVLAPVRND 126

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + Y+ LDCPPS  LLT+NAMAAADSIL+PLQ EF+ALEGL QLL+TV  +++++N  L I
Sbjct: 127 YDYVILDCPPSLTLLTINAMAAADSILIPLQSEFYALEGLGQLLQTVRRIKQSLNPPLKI 186

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            GI+LTMFD R +LS QV  D   +    V+ T IPRNVR+ EAPS+G P ++YD   AG
Sbjct: 187 AGILLTMFDQRTNLSNQVTEDAENHFADLVFKTRIPRNVRLGEAPSFGLPILLYDPASAG 246

Query: 244 SQAYLKLASELIQQER 259
           S++Y+ LA ELI++++
Sbjct: 247 SKSYMALARELIKRDQ 262


>gi|308274531|emb|CBX31130.1| Sporulation initiation inhibitor protein soj [uncultured
           Desulfobacterium sp.]
          Length = 262

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/254 (47%), Positives = 170/254 (66%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +  I IANQKGGVGKTTTA+NL+ +LA   +  L++D DPQGNA+TGLGI+    K + Y
Sbjct: 2   AHTICIANQKGGVGKTTTAVNLAASLAISEKKTLIVDCDPQGNATTGLGIDKTANKGNLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
             ++ E ++  IL  T I  L  IPS ++L+G E+ +     R   L   LS      F 
Sbjct: 62  HGMLGESDLESILADTEIEYLKAIPSNIELIGFEVEMMSHDGRELALKNLLSKAFDM-FE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS +LLT+NA+ A++ +L+PLQCEF+ALEGL QLL+TV+ +RR++N  L I G
Sbjct: 121 YIILDCPPSLSLLTVNALTASNYLLIPLQCEFYALEGLGQLLQTVKHIRRSLNPELKIAG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTM+D R +LS QV  D  K     ++ T++PRNVR+ EAPS+GKP ++YD    G++
Sbjct: 181 ILLTMYDKRTNLSVQVAEDAEKYFKNLIFKTIVPRNVRLGEAPSFGKPIMLYDAASIGAK 240

Query: 246 AYLKLASELIQQER 259
           +Y+ LA E+I   +
Sbjct: 241 SYISLAMEIISMAK 254


>gi|225028351|ref|ZP_03717543.1| hypothetical protein EUBHAL_02624 [Eubacterium hallii DSM 3353]
 gi|224954397|gb|EEG35606.1| hypothetical protein EUBHAL_02624 [Eubacterium hallii DSM 3353]
          Length = 256

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 180/256 (70%), Gaps = 3/256 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           SR+I IANQKGGVGKTTT+INLS  LA  G+ VLLID+D QGN ++G G E  +   + Y
Sbjct: 2   SRVIAIANQKGGVGKTTTSINLSACLAEKGKKVLLIDMDSQGNTTSGFGFEKNELDKTVY 61

Query: 66  DLLIEEKNINQILI--QTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
           ++L EE +I + +I  +    NL +IP+  +L G E+ L   ++    L K L   +  +
Sbjct: 62  EVLREEVSIEEAIIPVEECFENLFLIPANRNLAGAEIELVTRENMQHILKKQLE-PIKDE 120

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + +I +DCPP+  +LT+NAM AADS+LVP+QCEF+AL+GLSQL+ T+E ++ ++N  L I
Sbjct: 121 YDFIVIDCPPALGMLTVNAMTAADSVLVPIQCEFYALDGLSQLIYTIELIQESLNPDLYI 180

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++ TM+D+R +LS QVV +V+ NL   +Y T+IPRNVR++EAPSYG P  +YD + +G
Sbjct: 181 EGVVFTMYDARTNLSLQVVENVKDNLKQTIYKTIIPRNVRLAEAPSYGLPINLYDKRSSG 240

Query: 244 SQAYLKLASELIQQER 259
           ++AY  LA E+I+  +
Sbjct: 241 AEAYRMLADEVIENAK 256


>gi|50955950|ref|YP_063238.1| chromosome partitioning protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50952432|gb|AAT90133.1| chromosome partitioning protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 262

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 124/259 (47%), Positives = 176/259 (67%), Gaps = 2/259 (0%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
            +RI TI+NQKGGVGKTTT +NL  ALA  G  VL+IDLDPQGNAST L +E  +   S 
Sbjct: 4   HTRIFTISNQKGGVGKTTTVVNLGAALAKSGARVLVIDLDPQGNASTALSVEHREGTPSV 63

Query: 65  YDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS- 122
           YD+++ +K +  ++ ++     L +IP+T+DL G E+ L     R  RL +AL+  L   
Sbjct: 64  YDVIVNDKELEDVIQKSPEFHGLFVIPATIDLAGAEIELVSMVAREQRLSRALNRFLHEY 123

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           D  Y+ +DCPPS  LLT+NA  AA  +L+P+QCE++ALEGLSQLL+ ++ + R +N  L 
Sbjct: 124 DIDYVLIDCPPSLGLLTINAFVAATEVLIPIQCEYYALEGLSQLLKNIQLIERHLNPKLQ 183

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           +  I+LTM+DSR +L+ QV  DVR +   +V +T+IPR+VRISEAPSYG+  I YD   +
Sbjct: 184 VSTILLTMYDSRTNLANQVAEDVRSHFPNEVLDTIIPRSVRISEAPSYGQSVISYDANSS 243

Query: 243 GSQAYLKLASELIQQERHR 261
           GS +YL+ A+E+ ++   R
Sbjct: 244 GSLSYLEAAAEIARRGESR 262


>gi|254429807|ref|ZP_05043514.1| hypothetical protein ADG881_3037 [Alcanivorax sp. DG881]
 gi|196195976|gb|EDX90935.1| hypothetical protein ADG881_3037 [Alcanivorax sp. DG881]
          Length = 265

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 180/260 (69%), Gaps = 6/260 (2%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + +  +ANQKGGVGKTT+++NL+ +LAA  + V+L+D+DPQGNA+TG G++ ++  Y+ Y
Sbjct: 2   TTVFAVANQKGGVGKTTSSVNLAASLAATRKKVMLVDIDPQGNATTGSGVDKFETDYTIY 61

Query: 66  DLLIEEKNINQILIQTAIP---NLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
           D+L ++  I Q +  T  P      +I +  DL   E+ L     + FRL  AL+ ++  
Sbjct: 62  DVLCDDVAIEQAV--TGTPEDSGFDLIAANGDLTAAEVQLLDMSAKEFRLRNALA-RIRD 118

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + YI +DCPPS N+LT+NA+ AADS++VP+QCE++ALEGL+ L+ T+E++R  +N  L 
Sbjct: 119 QYDYILIDCPPSLNMLTVNALTAADSVIVPIQCEYYALEGLTALMNTIEKIRTVLNPKLH 178

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I G++ TM+D RNSLS  V + +  + G KVY T+IPRNVR++EAPS+G P I YD K  
Sbjct: 179 IGGLLRTMYDPRNSLSNDVSNQLISHFGDKVYRTIIPRNVRLAEAPSHGAPVITYDPKSR 238

Query: 243 GSQAYLKLASELIQQERHRK 262
           G+ +YL LA E++++E+  K
Sbjct: 239 GAVSYLALAGEILRREQALK 258


>gi|300115601|ref|YP_003762176.1| cobyrinic acid ac-diamide synthase [Nitrosococcus watsonii C-113]
 gi|299541538|gb|ADJ29855.1| Cobyrinic acid ac-diamide synthase [Nitrosococcus watsonii C-113]
          Length = 264

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 175/252 (69%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
            II I NQKGGVGKTTT++NL+ +LAA   +VLLID+DPQGNA+TG GI+      ++Y 
Sbjct: 3   HIIAITNQKGGVGKTTTSVNLAASLAAHKRSVLLIDMDPQGNATTGSGIDKSSLLATTYG 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+E+      LI+    N S++P+  DL   E+ L     R  RL  AL  ++  D+  
Sbjct: 63  VLLEDLAPGNALIKLGESNYSVLPANGDLTAAEVELLSAAKREHRLRIALQ-KIRYDYDE 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ N+LT+NA+ AAD +++P+QCE++ALEGLS LL T+E +++ +N  L I G+
Sbjct: 122 ILIDCPPALNMLTINALTAADGVIIPIQCEYYALEGLSALLNTIEGIQQRLNPRLHIAGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN+L+ +V S +  + G +VY+T+IPRNVR++EAPSYGKP ++YD    GS A
Sbjct: 182 LRTMFDPRNNLANEVSSQLMSHFGEQVYSTIIPRNVRLAEAPSYGKPVMLYDRSSRGSVA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++ +E
Sbjct: 242 YLVLAKEVLMRE 253


>gi|120435163|ref|YP_860849.1| ParA-like ATPase [Gramella forsetii KT0803]
 gi|117577313|emb|CAL65782.1| ParA-like ATPase [Gramella forsetii KT0803]
          Length = 253

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 179/251 (71%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + +LLID DPQ NA++GLGI++ + +  +Y 
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKILLIDADPQANATSGLGIDVEEVENGTYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL       + + +T+ PNL IIP+ +DL+ IE+ L  +++R   L KA+   L   + +
Sbjct: 63  LLEHSIKAEKAIQKTSSPNLDIIPAHIDLVAIEIELVDQENRESMLKKAIE-PLRDLYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  LLT+NA+ A+DS+++P+QCE+FALEGL +LL T++ V++  N+ LDI+G+
Sbjct: 122 ILIDCAPSLGLLTLNALTASDSVIIPIQCEYFALEGLGKLLNTIKSVQKIHNNKLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+DSR  LS QVV +V+K+    V+ T+I RNVR+SEAPSYG+  I YD    G+  
Sbjct: 182 LLTMYDSRLRLSNQVVEEVKKHFDEMVFETIIQRNVRLSEAPSYGESIINYDASSKGASN 241

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 242 YLSLAHEIIKK 252


>gi|290968090|ref|ZP_06559639.1| sporulation initiation inhibitor protein Soj [Megasphaera genomosp.
           type_1 str. 28L]
 gi|290781996|gb|EFD94575.1| sporulation initiation inhibitor protein Soj [Megasphaera genomosp.
           type_1 str. 28L]
          Length = 258

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/252 (45%), Positives = 171/252 (67%), Gaps = 3/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           + +I + NQKGGVGKTTTA+N+S  LA  G+  +LIDLDPQGNA++GLGI+    + S Y
Sbjct: 2   AHVIAVTNQKGGVGKTTTAVNVSACLAESGKKTVLIDLDPQGNATSGLGIDKSGLQRSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQ---LTS 122
           D LI+   + ++L  T +  L++ P+TMD+ G  + L G   R + L + +         
Sbjct: 62  DSLIDAMPLGEVLQPTLVKKLTVAPATMDVAGATIELVGMDAREYILKQRIHEWEQTAAE 121

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + Y+ +DCPPS  LLT+NA+ AAD +++P+QCEF+ALEGL+QL++TVE VR  +N  L 
Sbjct: 122 SYDYVIIDCPPSLGLLTINALTAADYVMIPVQCEFYALEGLAQLMQTVEMVRADLNRTLQ 181

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           + G++LTM+D R +LS QV  +V+K    +V+ T+IPRNVR+ EAPS+G+P  +YD +  
Sbjct: 182 LLGVVLTMYDGRTNLSIQVAEEVKKYFSSRVFKTIIPRNVRLGEAPSHGQPITVYDPRSK 241

Query: 243 GSQAYLKLASEL 254
           G++ Y KL  E+
Sbjct: 242 GTEVYKKLTKEV 253


>gi|42526123|ref|NP_971221.1| ParA family ATPase [Treponema denticola ATCC 35405]
 gi|41816235|gb|AAS11102.1| ParA family ATPase [Treponema denticola ATCC 35405]
          Length = 251

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 172/251 (68%), Gaps = 3/251 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +     NQKGGVGKTT+ INL   +A  G+  LLID DPQGN S+G+GI+   ++ + YD
Sbjct: 3   KTFVFVNQKGGVGKTTSVINLGAYIALAGKKTLLIDFDPQGNMSSGVGIQ--KKRPTIYD 60

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L ++ +I   +  T + NLS IP+++DL G  + L  E DR F L K +   + +++ Y
Sbjct: 61  ALAQKTSIKNTIYPTTVKNLSAIPASIDLSGATVELVDEADREFYL-KNIIESVKNEYDY 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+N + AAD + +PLQCE+FALEGL+ LL+TV+ V++ +N AL+I GI
Sbjct: 120 ILIDCPPSLGILTLNGLTAADQVYIPLQCEYFALEGLTLLLQTVQRVQQNLNPALEIGGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
             TMFDSR +L+Q+VV  V      KV++T+IPRNVR+SEAPS+G P   YD KC G+++
Sbjct: 180 FFTMFDSRTNLAQEVVQQVSSYFKDKVFSTIIPRNVRLSEAPSHGVPICNYDAKCTGARS 239

Query: 247 YLKLASELIQQ 257
           Y KLA E++ +
Sbjct: 240 YEKLADEVLNR 250


>gi|119357889|ref|YP_912533.1| chromosome segregation ATPase [Chlorobium phaeobacteroides DSM 266]
 gi|119355238|gb|ABL66109.1| chromosome segregation ATPase [Chlorobium phaeobacteroides DSM 266]
          Length = 265

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 118/258 (45%), Positives = 185/258 (71%), Gaps = 2/258 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR-KYSSY 65
           R+I IANQKGGVGKTTTA+N++ ++A      LLID+DPQ NA++G GIE  D    + Y
Sbjct: 3   RVIAIANQKGGVGKTTTAVNIAASIAISEFKTLLIDIDPQANATSGFGIETGDEIDNTFY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            ++++  +I   +  ++I  L ++PS ++L+G+E+ L   ++R + + KAL  Q+  ++ 
Sbjct: 63  QVMVKGGDIRDAIHTSSIGFLDVLPSNVNLVGMEVELVNMREREYVMQKALR-QVRDNYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  L+T+N++ AADS+L+P+Q E++ALEGL +LL T+  VR+ +N  L+I+G
Sbjct: 122 YIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPKLEIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TMFD+R  L+ QV S+VRK    +VY T I RNVR+SEAPS+GKP ++YD +C GS+
Sbjct: 182 VLVTMFDARLRLATQVASEVRKFFKDRVYRTYIRRNVRLSEAPSHGKPVLLYDAQCLGSK 241

Query: 246 AYLKLASELIQQERHRKE 263
            YL LA E+ +++ + K+
Sbjct: 242 DYLDLAMEIFERDGNIKK 259


>gi|71083059|ref|YP_265778.1| ParA family ATPase for plasmid partitioning and other plasmid
           related functions [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062172|gb|AAZ21175.1| ParA family ATPase for plasmid partitioning and other plasmid
           related functions [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 264

 Score =  246 bits (627), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 175/263 (66%), Gaps = 4/263 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIE-LYDRKYSSY 65
           +II+I NQKGGVGKTTT INL+  LA   + VL+IDLDPQGNA+TGLG+  L     + Y
Sbjct: 2   QIISIINQKGGVGKTTTVINLAAGLAQHEKKVLVIDLDPQGNATTGLGLSNLEGSTDTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT---S 122
            +L   + I+ ++ +T   NL II S +DL G+E+    +  R F L + L+  L    +
Sbjct: 62  GVLNGTRVISDVIRKTEFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAYLNDSRA 121

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + Y+ +DCPPS +LLT+ A+ ++ S+LVPLQ EFFALEGL+QL++T+E ++  +N  L 
Sbjct: 122 TYDYVLIDCPPSLSLLTVMALVSSHSLLVPLQTEFFALEGLTQLMKTIERIKVNLNPELK 181

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+LTMFD RN LS QV  + R     KVY TVIPRNVR+SEAPS+G P ++YD  C 
Sbjct: 182 IRGILLTMFDKRNKLSTQVEKEARDYFNEKVYLTVIPRNVRLSEAPSHGMPVLMYDKSCP 241

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GS++Y     E I QE+    AA
Sbjct: 242 GSKSYFNFTDEFINQEQTIGSAA 264


>gi|323703266|ref|ZP_08114917.1| Cobyrinic acid ac-diamide synthase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531731|gb|EGB21619.1| Cobyrinic acid ac-diamide synthase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 253

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 184/253 (72%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            +II IANQKGGV KTTTA+NL  +L+ +G+ VLL+D+DPQGNAS+G+GI+  D     Y
Sbjct: 2   GKIIAIANQKGGVAKTTTAVNLGASLSLMGQPVLLVDIDPQGNASSGVGIDKNDLDRCVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI E    +++I T I NL IIP+TM L G E+ +     R   L +AL V L   + 
Sbjct: 62  DVLINEVPPEEVIINTEIRNLDIIPATMQLAGAEVEMVSMLAREQILKRAL-VPLKDRYQ 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+AAA+S+L+P+QCEF+ALEG+ QL+ T++ V++ +N  L I+G
Sbjct: 121 YIIIDCPPSLGLLTLNALAAANSLLIPIQCEFYALEGVGQLMNTIQLVQKHLNPDLKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTMFD+R +LS QVV +V+K  G KV+  +IPRNVR+SEAPS+G P ++YD K  GS+
Sbjct: 181 VLLTMFDARLNLSIQVVDEVKKVFGTKVFKNIIPRNVRLSEAPSHGLPVVVYDPKSKGSE 240

Query: 246 AYLKLASELIQQE 258
           AY +LA E++  E
Sbjct: 241 AYRELAKEVMGIE 253


>gi|291457899|ref|ZP_06597289.1| sporulation initiation inhibitor protein Soj [Oribacterium sp. oral
           taxon 078 str. F0262]
 gi|291419443|gb|EFE93162.1| sporulation initiation inhibitor protein Soj [Oribacterium sp. oral
           taxon 078 str. F0262]
          Length = 254

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 175/252 (69%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII I NQKGGVGKTTTA+NL+  LA  G+ VLL+D DPQGNAS+GLG+E  + + S YD
Sbjct: 3   RIIAITNQKGGVGKTTTAVNLAATLAEAGQRVLLLDFDPQGNASSGLGVERSEIRSSIYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++     I + +++  + NL +IP+ M L   +  L   +++   L  AL   L   + Y
Sbjct: 63  VITGNSGIEETILRDWMENLDLIPADMSLAACDAELADVENKNLILRGALR-PLREKYEY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           + +DCPPS   +T+NA++AAD++L+P+QCE++ALEGL Q+L ++E V+  +N +L I+GI
Sbjct: 122 LLIDCPPSLGTITVNALSAADTVLIPIQCEYYALEGLRQVLSSIEIVQEALNPSLLIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D R  LSQ+VV  VRKN  G ++ ++IPRNVR++EAPS+G P   YD   +G+++
Sbjct: 182 VFTMYDGRIRLSQEVVRTVRKNFRGNIFQSMIPRNVRLAEAPSHGLPITAYDSASSGAES 241

Query: 247 YLKLASELIQQE 258
           Y KLA E++ +E
Sbjct: 242 YRKLAVEVMNRE 253


>gi|145221428|ref|YP_001132106.1| cobyrinic acid a,c-diamide synthase [Mycobacterium gilvum PYR-GCK]
 gi|145213914|gb|ABP43318.1| chromosome segregation ATPase [Mycobacterium gilvum PYR-GCK]
          Length = 336

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 169/253 (66%), Gaps = 5/253 (1%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS 64
           + R+ TIANQKGGVGKTTTA+N++ ALA  G  VL+IDLDPQGNAST LGIE      SS
Sbjct: 71  RQRVFTIANQKGGVGKTTTAVNIAAALALQGLRVLVIDLDPQGNASTALGIEHRPGTPSS 130

Query: 65  YDLLIEEKNINQILIQTAIPN---LSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
           Y++LI E  +   L ++  P+   L  IP+T+DL G E+ L     R  RL  AL+    
Sbjct: 131 YEVLIGEIGVESALQRS--PHNERLYCIPATIDLAGAEIELVSMVAREGRLRTALAELKH 188

Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181
            DF Y+F+DCPPS  LLT+NA+ AA  +L+P+QCE++ALEG+ QLL  +E V+  +N  L
Sbjct: 189 HDFDYVFIDCPPSLGLLTINALVAAPEVLIPIQCEYYALEGVGQLLRNIEMVKAHLNPEL 248

Query: 182 DIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKC 241
           D+  ++LTM D R  L+ QV +DVR++ G KV  TVIPR+V++SEAP YG   I YD   
Sbjct: 249 DVSTVVLTMHDGRTKLADQVANDVREHFGNKVLRTVIPRSVKVSEAPGYGMTIISYDPGS 308

Query: 242 AGSQAYLKLASEL 254
            G+ +YL  + EL
Sbjct: 309 RGAMSYLDASREL 321


>gi|108763547|ref|YP_635580.1| ParA family protein [Myxococcus xanthus DK 1622]
 gi|108467427|gb|ABF92612.1| ParA family protein [Myxococcus xanthus DK 1622]
          Length = 283

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 185/253 (73%), Gaps = 1/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
            RII I+NQKGGVGKTTTAINL+ +LA+     LL+D+DPQGNA +GLGI+  +   + Y
Sbjct: 22  GRIICISNQKGGVGKTTTAINLAASLASAERRTLLVDMDPQGNAGSGLGIKQDNITGTIY 81

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           + L+ ++ I ++L  T +  L ++P+T DL G E+ L  + +R FRL  AL   L +++ 
Sbjct: 82  EALLNDRPIQELLHPTELRYLQVVPATPDLTGAEVELVNQDNREFRLRDALR-PLAAEYD 140

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+AAADS+L+PLQCE++ALEGLSQL  T++ V++ +N  L ++G
Sbjct: 141 YIIIDCPPSLGLLTLNALAAADSVLIPLQCEYYALEGLSQLTHTIDLVKQGLNPDLKMEG 200

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+LTMFDSR +++ QVV +VR     +V+  ++PRNVR+SE PS+GKP I+YD+K  G +
Sbjct: 201 ILLTMFDSRANIAHQVVEEVRGYFKKQVFEVIVPRNVRLSECPSFGKPIILYDIKSKGCE 260

Query: 246 AYLKLASELIQQE 258
           +YL L  EL++++
Sbjct: 261 SYLALGRELMKRD 273


>gi|292493913|ref|YP_003529352.1| cobyrinic acid ac-diamide synthase [Nitrosococcus halophilus Nc4]
 gi|291582508|gb|ADE16965.1| Cobyrinic acid ac-diamide synthase [Nitrosococcus halophilus Nc4]
          Length = 264

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 120/252 (47%), Positives = 176/252 (69%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII I NQKGGVGKTTT++NL+ +LAA    VLLID+DPQGNA+TG GI+      ++YD
Sbjct: 3   RIIAITNQKGGVGKTTTSVNLAASLAAHKRGVLLIDMDPQGNATTGSGIDKSSLSATTYD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+E+   +  LI+      +++P+  DL   E+ L     R  RL  AL  ++  D+  
Sbjct: 63  VLLEDFAPHDALIKLEESGYTVLPANGDLTAAEVELLSASKRESRLRLALE-KIRYDYDE 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ N+LT+NA+ AAD +++P+QCE++ALEGLS LL T+E +++ +N  L I G+
Sbjct: 122 ILVDCPPALNMLTINALTAADGVIIPIQCEYYALEGLSALLNTIEGIQQRLNPELHIAGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN+L+ +V + +  + G +VY+T+IPRNVR++EAPSYGKP ++YD    GS A
Sbjct: 182 LRTMFDPRNNLANEVSNQLVSHFGQQVYSTIIPRNVRLAEAPSYGKPVMLYDRASRGSVA 241

Query: 247 YLKLASELIQQE 258
           YL LA E++ +E
Sbjct: 242 YLVLAKEVLMRE 253


>gi|313885544|ref|ZP_07819294.1| sporulation initiation inhibitor protein Soj [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619274|gb|EFR30713.1| sporulation initiation inhibitor protein Soj [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 253

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 177/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II + NQKGGVGKTTT +NL   LA++G+ VLL+D D QGNA++GLG+   D   S Y+
Sbjct: 3   KIIAVGNQKGGVGKTTTTVNLGAGLASLGKKVLLVDSDSQGNATSGLGVHRGDVDQSLYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LI++  I ++++ T+  NL I+PST+ L  IE+ L G K+R  RL +AL+  + +D+ +
Sbjct: 63  VLIDQIPIQEVILPTSRENLWIVPSTIQLAAIELELVGVKNRQNRLKEALA-PVEADYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS   L++NA  A+ +IL+P+Q E++A+EGL+QLL T+  V++  N    I+G+
Sbjct: 122 ILIDCPPSLGQLSINAFTASHTILIPVQAEYYAMEGLTQLLNTIRLVQKNYNRDFRIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           ++TM D+R +L  +VV +VRK    KVY T+IPRNVR+SEAPSYG   I YD K  G++ 
Sbjct: 182 LITMLDARTNLGFEVVEEVRKYFQEKVYQTMIPRNVRLSEAPSYGLSIIDYDRKSRGAER 241

Query: 247 YLKLASELI 255
           YL+LA E+I
Sbjct: 242 YLELAKEVI 250


>gi|295394853|ref|ZP_06805066.1| sporulation initiation inhibitor protein Soj [Brevibacterium
           mcbrellneri ATCC 49030]
 gi|294972186|gb|EFG48048.1| sporulation initiation inhibitor protein Soj [Brevibacterium
           mcbrellneri ATCC 49030]
          Length = 298

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 173/261 (66%), Gaps = 7/261 (2%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           + +RI TIANQKGGVGKTTT +N++ ALA  G  VL+ID+DPQGNAST LGIE      S
Sbjct: 33  QSTRIFTIANQKGGVGKTTTTVNIAAALAKHGLQVLVIDIDPQGNASTALGIEHSTDVNS 92

Query: 64  SYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT- 121
            Y++L++   + +++     I NLS +P+T+DL G E+ L     R FRL +AL   L  
Sbjct: 93  VYEVLLDGMEMAEVVSDCPDIENLSAVPATIDLAGAEIELVSVHAREFRLKRALESYLEQ 152

Query: 122 -----SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176
                +   Y+F+DCPPS  LLT+NA  AA+ +L+P+QCE++ALEGLSQLL  ++ +++ 
Sbjct: 153 RKADGNPVDYVFIDCPPSLGLLTVNAFVAAEEVLIPIQCEYYALEGLSQLLNNIQLIQKH 212

Query: 177 VNSALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236
           +N  L +  I+LTM+D R +LS QV  DVR +   +  NT IPRNVRISEAPSYGK  I 
Sbjct: 213 LNPQLSVSTILLTMYDGRTNLSSQVAEDVRAHFPAQTLNTPIPRNVRISEAPSYGKTVIT 272

Query: 237 YDLKCAGSQAYLKLASELIQQ 257
           YD    G+ +Y + A E+ ++
Sbjct: 273 YDPNSPGALSYREAAEEIAER 293


>gi|91762515|ref|ZP_01264480.1| ParA family ATPase [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718317|gb|EAS84967.1| ParA family ATPase [Candidatus Pelagibacter ubique HTCC1002]
          Length = 264

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/263 (48%), Positives = 176/263 (66%), Gaps = 4/263 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIE-LYDRKYSSY 65
           +II++ NQKGGVGKTTT INL+  LA   + VL+IDLDPQGNA+TGLG+  L     + Y
Sbjct: 2   QIISVINQKGGVGKTTTVINLAAGLAQHKKKVLVIDLDPQGNATTGLGLSNLESSTDTIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT---S 122
            +L   + I+ ++ +TA  NL II S +DL G+E+    +  R F L + L+  L    +
Sbjct: 62  GVLNGTRIISDVIRKTAFKNLDIITSNVDLSGLEVETADDSMRAFILKRELTAFLNDSRA 121

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + Y+ +DCPPS +LLT+ ++ ++ S+LVPLQ EFFALEGL+QL++T+E ++  +N  L 
Sbjct: 122 TYDYVLIDCPPSLSLLTVMSLVSSHSLLVPLQTEFFALEGLTQLMKTIERIKINLNPELK 181

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I+GI+LTMFD RN LS QV  + R     KVY TVIPRNVR+SEAPS+G P ++YD  C 
Sbjct: 182 IRGILLTMFDKRNKLSTQVEKEARDYFNEKVYLTVIPRNVRLSEAPSHGLPVLMYDKSCP 241

Query: 243 GSQAYLKLASELIQQERHRKEAA 265
           GS++Y     E I QE+    AA
Sbjct: 242 GSKSYFNFTDEFINQEQKIGSAA 264


>gi|317496041|ref|ZP_07954402.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Gemella moribillum M424]
 gi|316913847|gb|EFV35332.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Gemella moribillum M424]
          Length = 252

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 120/251 (47%), Positives = 178/251 (70%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I+ I NQKGGVGKTTT+INL+ +LA + + VLLID DPQ NA++G+GI+    + S Y+
Sbjct: 2   KILAICNQKGGVGKTTTSINLAASLAHLKKKVLLIDTDPQANATSGVGIDKAGLEQSIYN 61

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L++E +IN ++I+TA  NL I+PS++ L G E+ L     R  R+  A++  +   + Y
Sbjct: 62  ILVDEVDINNVIIKTAYENLDIVPSSIALAGAEVELVSAISREQRMKNAIA-DIKEKYDY 120

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  L+T+N++ AAD +++P+Q E++ALEGLSQL+ T   VR+ +NS LDI G+
Sbjct: 121 IIIDCPPSLGLITLNSLTAADGVIIPVQTEYYALEGLSQLMNTFNIVRKHLNSRLDIFGV 180

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM DSR ++S QV   VR++  GK + TVI R VR+SEAPS+G+P I Y     G++ 
Sbjct: 181 LLTMTDSRTNISNQVGEQVREHFKGKAFETVISRTVRLSEAPSFGEPIIEYAKNSNGAKQ 240

Query: 247 YLKLASELIQQ 257
           YL LA E+I++
Sbjct: 241 YLSLAKEVIER 251


>gi|189347535|ref|YP_001944064.1| Cobyrinic acid ac-diamide synthase [Chlorobium limicola DSM 245]
 gi|189341682|gb|ACD91085.1| Cobyrinic acid ac-diamide synthase [Chlorobium limicola DSM 245]
          Length = 265

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 181/253 (71%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR-KYSSY 65
           R+I IANQKGGVGKTTTA+N++ ++A      LLID+DPQ NA++G GIE  D    + Y
Sbjct: 3   RVIAIANQKGGVGKTTTAVNIAASIAISEFRTLLIDIDPQANATSGFGIETGDEIDNTFY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            ++++  NI   + Q+++  L ++PS ++L+G+E+ L   ++R + + KAL   + S + 
Sbjct: 63  QVMVKGGNIEDAIHQSSLEYLDVLPSNVNLVGMEVELVNMREREYVMQKALR-DVRSRYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  L+T+N++ AADS+L+P+Q E++ALEGL +LL T+  VR+ +N  L+I+G
Sbjct: 122 YIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPKLEIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TMFDSR  L+ QV  +V+K    KVY T I RNVR+SEAPS+GKPA++YD +  GS+
Sbjct: 182 VLVTMFDSRLRLATQVAEEVKKFFKDKVYKTYIRRNVRLSEAPSHGKPALLYDAQSLGSK 241

Query: 246 AYLKLASELIQQE 258
            YL LA E+ +++
Sbjct: 242 DYLDLAREIFERD 254


>gi|326797437|ref|YP_004315257.1| cobyrinic acid ac-diamide synthase [Marinomonas mediterranea MMB-1]
 gi|326548201|gb|ADZ93421.1| Cobyrinic acid ac-diamide synthase [Marinomonas mediterranea MMB-1]
          Length = 256

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 118/252 (46%), Positives = 175/252 (69%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II + NQKGGVGKTTT +NL+ +LAA+   VLLIDLDPQGNA+TG G+   +   S +
Sbjct: 2   AKIIAVTNQKGGVGKTTTCVNLAASLAAMKRRVLLIDLDPQGNATTGSGLAKEELDTSVF 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI    +  ++         ++P+  DL G E++L     +  RL  +L  ++ +DF 
Sbjct: 62  DVLIGTHGVKDVMKLCESAGYHVLPANGDLTGAEVVLLDLPSKETRLRASL-YEVENDFD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           ++ LDCPPS N+LT+NA+AAA S+L+P+QCE++ALEGLS LL+T+E +   +N AL I+G
Sbjct: 121 FVLLDCPPSLNMLTVNALAAAQSVLIPVQCEYYALEGLSALLQTIETISGALNPALSIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           II TM+D R SL+  V S + ++ G KV++TVIPRN+R++EAPSYG P + Y+ +  G+ 
Sbjct: 181 IIRTMYDPRPSLTHDVSSQLLEHFGEKVFDTVIPRNIRLAEAPSYGLPVLHYEKQSRGAI 240

Query: 246 AYLKLASELIQQ 257
           AYL LA E +++
Sbjct: 241 AYLALAGEFVRK 252


>gi|114332387|ref|YP_748609.1| cobyrinic acid a,c-diamide synthase [Nitrosomonas eutropha C91]
 gi|114309401|gb|ABI60644.1| chromosome segregation ATPase [Nitrosomonas eutropha C91]
          Length = 254

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 179/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RI+ IANQKGGVGKTTT+INL+ +LA+IG+ VLL+DLDPQGN + G G++     ++ Y 
Sbjct: 3   RILAIANQKGGVGKTTTSINLAASLASIGKRVLLVDLDPQGNTTMGSGVDKRLLDHTVYQ 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ E+ I ++ + T      ++P+  +L G E+ +   + R  RL +AL   + +D+ +
Sbjct: 63  ILLGEQTIAKVRLSTKPGKYDLLPANQELAGAEVEMVSLEQRESRLKEALQA-IQADYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+ NLLT+N + AA ++++P+QCE++ALEGLS L+ T++ VR   N ++ I+G+
Sbjct: 122 ILIDCPPALNLLTLNGLCAAHAVIIPMQCEYYALEGLSDLVNTIKRVRMGFNPSIRIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD RN L+QQV   ++++ G KVY T+IPRN+R++EAP +G P + +D +  G++A
Sbjct: 182 LRTMFDPRNLLAQQVSDQLKQHFGNKVYQTIIPRNIRLAEAPGFGLPVLYHDRQSRGARA 241

Query: 247 YLKLASELI 255
           YL+LA+E++
Sbjct: 242 YLELANEIL 250


>gi|289666319|ref|ZP_06487900.1| chromosome partitioning protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289671108|ref|ZP_06492183.1| chromosome partitioning protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 265

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 120/258 (46%), Positives = 182/258 (70%), Gaps = 2/258 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTA+NL+  LA   + VLL+DLD QGNA+ G GI+  D   S+ 
Sbjct: 2   ARIIAIANQKGGVGKTTTAVNLAAGLARAPKRVLLVDLDSQGNATMGSGIDKRDVAASTC 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLL+ E    +I + TA     ++P  +DL   E+ L  + +R  RL +AL+  + +++ 
Sbjct: 62  DLLLGENTAAEIRV-TAPEGFDLLPGNIDLTAAEIQLMDQGEREQRLKRALA-PIRNEYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           +I +DCPP+ +LLT+NA+ AADSI+VP+QCE++ALEGL+ LLET+E +R  +N  L+I+G
Sbjct: 120 FILIDCPPALSLLTLNALTAADSIIVPMQCEYYALEGLTALLETIEALRANLNPELEIEG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TMFD RN+L+  V +++ ++ G KV+ T++PRNVR++EAPS+G+  + YD    G  
Sbjct: 180 VLRTMFDIRNNLANAVSAELTEHFGDKVFRTIVPRNVRLAEAPSHGQSIVGYDRTSRGGV 239

Query: 246 AYLKLASELIQQERHRKE 263
           AYL LA E+++++  R +
Sbjct: 240 AYLGLAGEIVRRQNDRNK 257


>gi|224823523|ref|ZP_03696632.1| Cobyrinic acid ac-diamide synthase [Lutiella nitroferrum 2002]
 gi|224603978|gb|EEG10152.1| Cobyrinic acid ac-diamide synthase [Lutiella nitroferrum 2002]
          Length = 263

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 119/248 (47%), Positives = 171/248 (68%), Gaps = 1/248 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+I +ANQKGGVGKTTT +NL+  LA +G  VL++DLDPQGNA+ G GI       S Y 
Sbjct: 4   RVIAVANQKGGVGKTTTVVNLAAGLAEMGRRVLIVDLDPQGNATMGSGIAKGSLATSVYQ 63

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+ +  + +           ++P+  D+ G E+ L  E  R  RL  AL  ++  ++ Y
Sbjct: 64  VLLGDVGVAEARQPAKEGGYHVLPANRDVGGAELELVHELAREARLKNALG-EVLGEYDY 122

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS NLLT+N + AA+S+L+P+ CE++ALEGLS L+ T+ +VR  VN  ++I G+
Sbjct: 123 IFVDCPPSLNLLTLNGLVAAESVLIPMVCEYYALEGLSDLVTTLRKVRVAVNPKIEILGL 182

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD+R++LSQQV   + ++ G KV++TVIPRNVR++EAPS+G P +IYD    G+QA
Sbjct: 183 LRTMFDARSNLSQQVSQQLARHFGDKVFDTVIPRNVRLAEAPSHGLPGLIYDRNSRGAQA 242

Query: 247 YLKLASEL 254
           YL LA+EL
Sbjct: 243 YLTLAAEL 250


>gi|225620008|ref|YP_002721265.1| sporulation initiation inhibitor protein Soj [Brachyspira
           hyodysenteriae WA1]
 gi|225214827|gb|ACN83561.1| sporulation initiation inhibitor protein Soj [Brachyspira
           hyodysenteriae WA1]
          Length = 254

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 174/254 (68%), Gaps = 1/254 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S++I I NQKGGVGKTTTA+NLS  +A +G   LLID+DPQ NA  G+GI     + S Y
Sbjct: 2   SKVIAIVNQKGGVGKTTTAVNLSANIAKMGHKTLLIDIDPQANACLGIGITRDQMQKSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+LI + +  ++++ T   NL +IP+  DL+G ++ L  E  R ++L KA+   + +D+ 
Sbjct: 62  DILIGQADAKEVIMPTYQENLFLIPADSDLVGAQIELVNEIAREYKLKKAVEA-IKNDYE 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPP+  +LT+NA+ AADS+L+P+QCEF+AL+G+++L  T+  V+  +N  L I+G
Sbjct: 121 YIIIDCPPTLGILTLNALTAADSVLIPIQCEFYALDGVAELNNTIALVKENLNKELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM+D+R  L+  VV +V      K Y T+IPRNVR+SEAPSYGK    YD  C G++
Sbjct: 181 VLLTMYDARTKLASDVVKEVVNFFKEKTYKTMIPRNVRLSEAPSYGKAIGDYDKDCVGAR 240

Query: 246 AYLKLASELIQQER 259
           +Y + A E +++ +
Sbjct: 241 SYKEFAKEFVEKSK 254


>gi|124516567|gb|EAY58075.1| putative cobyrinic acid a,c-diamide synthase (CbiA) [Leptospirillum
           rubarum]
          Length = 254

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 168/250 (67%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++++ +ANQKGGVGKTTT INL+ ++A   + VL+IDLDPQGN+++GLG+       S+Y
Sbjct: 2   AKVVAVANQKGGVGKTTTTINLAASMAVEEKKVLVIDLDPQGNSTSGLGVNATKSTPSAY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D LI  K++   +I+  +  L ++P ++++ G E      K     L   L       F 
Sbjct: 62  DFLIGNKSVEDAVIEAHLKYLYVLPGSLNMAGFESEAASVKGSQELLRGKLQDPYFEQFQ 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI LDCPPS   +T+NA+ +A SIL+P+QCEFFALEGLS LL+T+E VR+  N  L+++G
Sbjct: 122 YILLDCPPSLGYITLNALVSASSILIPVQCEFFALEGLSHLLKTIERVRKQWNPDLEVEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D RN LS QV+ D+R +    V+ +VIPRNV + EAPSYGKP +++D    G+Q
Sbjct: 182 ILPTMYDKRNKLSNQVLEDLRDHFPELVFKSVIPRNVTLGEAPSYGKPVLLHDALSKGAQ 241

Query: 246 AYLKLASELI 255
           +YL LA E++
Sbjct: 242 SYLHLAREIL 251


>gi|183222813|ref|YP_001840809.1| chromosome partitioning protein ParA [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189912845|ref|YP_001964400.1| ParA-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167777521|gb|ABZ95822.1| ParA-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167781235|gb|ABZ99533.1| Chromosome partitioning protein ParA [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 253

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 178/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +I++I+NQKGGVGKTTTAINL++ L  +G+ VLL+D+DPQGN+ +GLG+E+     ++Y+
Sbjct: 3   KIVSISNQKGGVGKTTTAINLASNLVDLGKKVLLLDIDPQGNSGSGLGLEVQSLSKTTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++I E +  + + +T IPNL IIPS ++L G+E+   G + + F+L  AL+  +   + Y
Sbjct: 63  VMIGELSAREAIQKTFIPNLDIIPSNINLSGLEVDFLGIEKKEFKLKDALA-SIKESYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+NA+ A+ S+++ LQ E+FALEGLSQL+  +  V+   N +L ++G+
Sbjct: 122 ILIDCPPSLGVLTINALCASQSVMITLQTEYFALEGLSQLMRIISLVQSQWNPSLALEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D R +L+ QV  DVR     KVY TVIPRN+++SEAPS+GKP   YD    G+++
Sbjct: 182 LLTMYDKRTNLANQVADDVRNYFKEKVYETVIPRNIKLSEAPSFGKPINYYDPDGVGAKS 241

Query: 247 YLKLASELI 255
           Y  LA E++
Sbjct: 242 YKSLAEEIV 250


>gi|325275321|ref|ZP_08141274.1| cobyrinic acid a,c-diamide synthase [Pseudomonas sp. TJI-51]
 gi|324099569|gb|EGB97462.1| cobyrinic acid a,c-diamide synthase [Pseudomonas sp. TJI-51]
          Length = 263

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 114/260 (43%), Positives = 183/260 (70%), Gaps = 1/260 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +++  IANQKGGVGKTTT INL+ +LAA    VLLIDLDPQGNA+ G G++ ++ ++S Y
Sbjct: 2   AKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELEHSVY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           DLLI E ++ Q +  +      ++P+  DL   E++L   + +  RL  AL+  +  ++ 
Sbjct: 62  DLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALA-PIRDNYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS ++LT+NA+ AAD +++P+QCE++ALEGLS L++ ++ +   +N  L I+G
Sbjct: 121 YILIDCPPSLSMLTLNALVAADGVIIPMQCEYYALEGLSDLVDNIKRIAARLNPELKIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++ TM+D R SL+  V + ++++ G ++Y+TVIPRN+R++EAPS+G PA+ YD +  G+ 
Sbjct: 181 LLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIRLAEAPSFGMPALAYDKQSRGAL 240

Query: 246 AYLKLASELIQQERHRKEAA 265
           AYL LA EL++++R +   A
Sbjct: 241 AYLALAGELVRRQRRQSRTA 260


>gi|237786649|ref|YP_002907354.1| chromosome partitioning protein ParA [Corynebacterium
           kroppenstedtii DSM 44385]
 gi|237759561|gb|ACR18811.1| chromosome partitioning protein ParA [Corynebacterium
           kroppenstedtii DSM 44385]
          Length = 314

 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 176/259 (67%), Gaps = 4/259 (1%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELY-DRKY 62
           + +R I +ANQKGGVGKTT+ +NL+ AL+  G+ VL++DLDPQGNAST L  E   +   
Sbjct: 39  RHTRKIALANQKGGVGKTTSTVNLAWALSLRGQKVLVVDLDPQGNASTALSAEHRAEGTP 98

Query: 63  SSYDLLIEE-KNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLT 121
           S+Y+++I E +  + +    + PN+  IP+T+DL G EM L    +R +R+ + L  +  
Sbjct: 99  STYEVIIGEIEPKDAVQAHPSNPNMFTIPATIDLAGAEMELANGYNREYRVAQMLGDEGI 158

Query: 122 SD--FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNS 179
            D  F YIF+DCPPS  LLT+N +  A+ I++P+QCEF+ALEG++QL E V  +R  +N 
Sbjct: 159 DDMGFDYIFIDCPPSLGLLTINGLTGANEIIIPIQCEFYALEGVTQLTENVRLIREALNP 218

Query: 180 ALDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDL 239
            LDI G++LTM+DSR +LS  V +DVR++ G  V++ VIPRNVR+SEAPSYG+  I +D 
Sbjct: 219 NLDITGVLLTMYDSRTNLSHDVENDVRESFGSLVFDRVIPRNVRVSEAPSYGQTVIEHDA 278

Query: 240 KCAGSQAYLKLASELIQQE 258
              GS AY+    EL ++E
Sbjct: 279 GSPGSAAYMAAVEELARRE 297


>gi|167748069|ref|ZP_02420196.1| hypothetical protein ANACAC_02813 [Anaerostipes caccae DSM 14662]
 gi|167652061|gb|EDR96190.1| hypothetical protein ANACAC_02813 [Anaerostipes caccae DSM 14662]
          Length = 257

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/249 (46%), Positives = 177/249 (71%), Gaps = 1/249 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           RII IANQKGGVGKTTTA+NLS ALAA G+  L+ID+DPQGN +TGLG++  + +++ Y+
Sbjct: 3   RIIAIANQKGGVGKTTTAVNLSAALAAAGKKTLIIDMDPQGNTTTGLGLDKNELEHTVYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           ++  E   ++ +    I NLS+ P+  +L G E+ L    DR+  + K        +F +
Sbjct: 63  VISSEITFDECICPEVIENLSLAPANRNLAGAEIELM-TVDRMQYILKEKLQPTVENFEF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+  +LT+NAM AAD+++VP+QCEF+AL+GL+QL+ T+E +++++N  L I+G 
Sbjct: 122 IIIDCPPALGMLTVNAMTAADTVIVPIQCEFYALDGLTQLMYTIELIQKSLNPDLKIEGA 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D+R +LS QVV +V+  L   +Y T+IPRNVR++EAPS+G P  +YD K  G+++
Sbjct: 182 VFTMYDARTNLSLQVVENVKSYLNQNIYKTIIPRNVRLAEAPSHGLPINLYDPKSVGAES 241

Query: 247 YLKLASELI 255
           Y  LA E+I
Sbjct: 242 YQMLAEEVI 250


>gi|304437859|ref|ZP_07397807.1| sporulation initiation inhibitor protein Soj [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
 gi|304369159|gb|EFM22836.1| sporulation initiation inhibitor protein Soj [Selenomonas sp. oral
           taxon 149 str. 67H29BP]
          Length = 254

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 183/253 (72%), Gaps = 2/253 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++II +A+QKGGVGKTTTA+NL+ A+A     VLLID+DPQGNA++  GI+      ++Y
Sbjct: 2   AKIIAVASQKGGVGKTTTAVNLAAAVARAKRRVLLIDIDPQGNATSAFGIDKSTLPATTY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +LI+ K++ +++I++    + ++P+ ++L G E+ L   + R  RL KA++  LT D+ 
Sbjct: 62  RVLIDGKHMREVIIESDY-LVDVVPANVELAGAEVELASLEHRETRLRKAIAEVLT-DYD 119

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+NA+ AA ++L+P+QCEFFALEG++QL++T+  V+   N  L +QG
Sbjct: 120 YIFIDCPPSLGFLTLNALTAAHAVLIPIQCEFFALEGVAQLMKTISLVKERANPKLRVQG 179

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TM+DSR  ++ QVV +VR   G  +Y T+IPRNVR+SEAPS+G+P   YD+   G++
Sbjct: 180 VVMTMYDSRTRIAGQVVDEVRDVFGDALYQTMIPRNVRLSEAPSFGQPITSYDITSRGAE 239

Query: 246 AYLKLASELIQQE 258
            Y+ LA E+I++E
Sbjct: 240 MYIALAREVIRRE 252


>gi|332880038|ref|ZP_08447722.1| sporulation initiation inhibitor protein Soj [Capnocytophaga sp.
           oral taxon 329 str. F0087]
 gi|332682034|gb|EGJ54947.1| sporulation initiation inhibitor protein Soj [Capnocytophaga sp.
           oral taxon 329 str. F0087]
          Length = 256

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 116/253 (45%), Positives = 181/253 (71%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ +L  + + VLLID DPQ NA++GLGI +   ++ +Y+
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANATSGLGINVDSIEHGTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL    +   ++I T+ PNL +I + ++L+ IE+ L  +++R + L KAL+  +   + Y
Sbjct: 63  LLEHTMDAKDMIIHTSSPNLDLIAAHINLVAIEIELVDKQEREYMLKKALA-PIRDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+NA+ AA+S++VP+QCE+FALEGL +LL T++ V+++ N  LDI+G+
Sbjct: 122 ILIDCAPSLGLITLNALTAANSVIVPIQCEYFALEGLGKLLNTIKSVQKSFNPNLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D+R  LS QVV +V+K+    V+ T+I RNVR+SEAPS+G+  I YD    G+  
Sbjct: 182 LLTMYDARLRLSNQVVEEVQKHFSNMVFKTIIQRNVRLSEAPSFGETIINYDATSKGATN 241

Query: 247 YLKLASELIQQER 259
           ++ LA E+I + +
Sbjct: 242 HINLAQEIIDKNK 254


>gi|193216346|ref|YP_001997545.1| cobyrinic acid ac-diamide synthase [Chloroherpeton thalassium ATCC
           35110]
 gi|193089823|gb|ACF15098.1| Cobyrinic acid ac-diamide synthase [Chloroherpeton thalassium ATCC
           35110]
          Length = 345

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 179/252 (71%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +++ +ANQKGGVGKTTTA+NL+ ++AA     LLID+DPQ NA++G G+ L +  +S Y+
Sbjct: 3   KVLAVANQKGGVGKTTTAVNLAASIAAAEVPTLLIDIDPQANATSGSGVTLTEEAHSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +LIE  +I   +I +++  L ++PS ++L+G E+ L    +R   L  AL   +   + Y
Sbjct: 63  VLIEHADIESTVIPSSMQYLDVVPSDINLVGTEVELIDVPERERVLYHALG-SVRKKYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  L+T+NA+ A+D++++P+Q E++ALEGL QLL T+  VRR +N  LDI+G+
Sbjct: 122 IIIDCPPSLGLITLNALTASDAVVIPVQAEYYALEGLGQLLNTISIVRRHLNPTLDIEGV 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFD R  LS QV+ +V+K    KV+ TVI RNV+ISEAPS+G+P I+YD +  G++ 
Sbjct: 182 LLTMFDGRLRLSNQVMEEVKKYFKEKVFTTVIRRNVKISEAPSHGRPVILYDAQSIGTKD 241

Query: 247 YLKLASELIQQE 258
           Y+ LA E+ +++
Sbjct: 242 YMDLAYEIFKRD 253


>gi|198276299|ref|ZP_03208830.1| hypothetical protein BACPLE_02493 [Bacteroides plebeius DSM 17135]
 gi|198270741|gb|EDY95011.1| hypothetical protein BACPLE_02493 [Bacteroides plebeius DSM 17135]
          Length = 255

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 185/253 (73%), Gaps = 5/253 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II +ANQKGGVGKTTT INL+ +LA + + VL+ID DPQ NAS+GLG++L D   S Y+
Sbjct: 3   KIIALANQKGGVGKTTTTINLAASLATLEKKVLVIDADPQANASSGLGVDLKDIDCSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLTSDF 124
            LI + +I + +  T I  L IIPS +DL+G  IEM+    ++++ R  +AL   + S++
Sbjct: 63  CLINQADIREAIYTTDIDGLDIIPSHIDLVGAEIEMLNLENREKIMR--RALE-PMKSEY 119

Query: 125 SYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQ 184
            YI +DC PS  L+T+NA+ AADS+++P+QCE+FALEG+S+LL T++ ++  +N +L+I+
Sbjct: 120 DYILIDCSPSLGLITINALTAADSVIIPVQCEYFALEGISKLLNTIKIIKTKLNPSLEIE 179

Query: 185 GIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGS 244
           G +LTMFDSR  L+ Q+  +V+++    V+ T+I RNV++SEAPS+G PAI+YD +  G+
Sbjct: 180 GFLLTMFDSRLRLANQIYDEVKRHFQELVFKTIIQRNVKLSEAPSHGIPAILYDAESTGA 239

Query: 245 QAYLKLASELIQQ 257
           + +L LA+E+I +
Sbjct: 240 KNHLALANEIITR 252


>gi|325473632|gb|EGC76822.1| ParA family ATPase [Treponema denticola F0402]
          Length = 251

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 173/251 (68%), Gaps = 3/251 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +     NQKGGVGKTT+ INL   +A  G+  LLID DPQGN S+G+GI+   ++ + YD
Sbjct: 3   KTFVFVNQKGGVGKTTSVINLGAYIALAGKKTLLIDFDPQGNMSSGVGIQ--KKRPTIYD 60

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            L ++ +I   +  T + NLS IP+++DL G  + L  E DR F L K +   + +++ Y
Sbjct: 61  ALAQKTSIKNTIYPTTVKNLSAIPASIDLSGATVELVEEADREFYL-KNIIESVKNEYDY 119

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPPS  +LT+N + AAD + +PLQCE+FALEGL+ LL+TV+ V++++N +L+I GI
Sbjct: 120 ILIDCPPSLGILTLNGLTAADQVYIPLQCEYFALEGLTLLLQTVQRVQQSLNPSLEIGGI 179

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
             TMFDSR +L+Q+VV  V      KV++T+IPRNVR+SEAPS+G P   YD KC G+++
Sbjct: 180 FFTMFDSRTNLAQEVVQQVSSYFKDKVFSTIIPRNVRLSEAPSHGIPICNYDAKCTGARS 239

Query: 247 YLKLASELIQQ 257
           Y KLA E++ +
Sbjct: 240 YEKLADEVLNR 250


>gi|127514779|ref|YP_001095976.1| cobyrinic acid a,c-diamide synthase [Shewanella loihica PV-4]
 gi|126640074|gb|ABO25717.1| chromosome segregation ATPase [Shewanella loihica PV-4]
          Length = 262

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 123/257 (47%), Positives = 183/257 (71%), Gaps = 2/257 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I +ANQKGGVGKTTT +NL+ +LAA    VLLIDLDPQGNA+ G G++ Y  + ++Y+
Sbjct: 3   KVIAVANQKGGVGKTTTCVNLAASLAATKRKVLLIDLDPQGNATMGSGVDKYSVENTAYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL+EEK++ +++ +       +I    D+   E+ L     R  RL  AL+  +   + +
Sbjct: 63  LLVEEKSVEEVVYRDTAGKYDLIAGNGDVTAAEIKLMEFFAREIRLRNALA-PVKDYYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           IF+DCPPS N+LT+NAM+AADS+LVP+QCE++ALEGL+ L++T+ ++   VN  L I+GI
Sbjct: 122 IFIDCPPSLNMLTVNAMSAADSVLVPMQCEYYALEGLTALMDTISKLAAMVNPGLSIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TM+D RN L+  V   ++++ G KVY TVIPRNVR++EAPS+G PA+ YD   AG++A
Sbjct: 182 LRTMYDPRNRLANDVSDQLKQHFGDKVYRTVIPRNVRLAEAPSFGAPAMYYDKSSAGAKA 241

Query: 247 YLKLASELIQQ-ERHRK 262
           YL LA E+I++ E+H +
Sbjct: 242 YLALAGEIIRRAEQHSQ 258


>gi|30250395|ref|NP_842465.1| ParA family ATPase [Nitrosomonas europaea ATCC 19718]
 gi|30181190|emb|CAD86386.1| ParA family ATPase [Nitrosomonas europaea ATCC 19718]
          Length = 254

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 181/252 (71%), Gaps = 5/252 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIE--LYDRKYS 63
           +RI  IANQKGGVGKTTT+INL+++LA+I + VLL+DLDPQGN + G G++  L DR  +
Sbjct: 2   TRIFAIANQKGGVGKTTTSINLASSLASIDKRVLLVDLDPQGNTTMGSGVDKRLLDR--T 59

Query: 64  SYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            Y +L+ E+   ++ + T      ++P+  +L G E+ +   + R  RL KAL V + +D
Sbjct: 60  VYQILLGEQVAAEVRLSTKPGKYDLLPANQELAGAEVEMVALEQRESRLKKALQV-IQAD 118

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + +I +DCPP+ NLLT+N + AA ++++P+QCE++ALEGLS L+ T++ VR   N A+ I
Sbjct: 119 YDFILIDCPPALNLLTLNGLCAAHAVIIPMQCEYYALEGLSDLVNTIKRVRTGFNPAIRI 178

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
           +G++ TMFD RN L+QQV   ++++ G KVY T+IPRN+R++EAP +G P + +D +  G
Sbjct: 179 EGLLRTMFDPRNLLAQQVSDQLKQHFGDKVYRTIIPRNIRLAEAPGFGLPVLYHDKQSRG 238

Query: 244 SQAYLKLASELI 255
           +QAYL+LA+E++
Sbjct: 239 AQAYLELANEIL 250


>gi|325298620|ref|YP_004258537.1| Cobyrinic acid ac-diamide synthase [Bacteroides salanitronis DSM
           18170]
 gi|324318173|gb|ADY36064.1| Cobyrinic acid ac-diamide synthase [Bacteroides salanitronis DSM
           18170]
          Length = 254

 Score =  244 bits (624), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 182/253 (71%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT INL+ +LA + + VL+ID DPQ NAS+GLG++L +   S Y+
Sbjct: 3   KIIAIANQKGGVGKTTTTINLAASLATLEKKVLVIDADPQANASSGLGVDLKEIDCSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            LI + +I + +  T I  L IIPS +DL+G E+ +    +R   + KAL+  + +++ Y
Sbjct: 63  CLINQNDIREAIYTTDIDGLDIIPSHIDLVGAEIEMLNLDNREKIMKKALA-PMVNEYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+NA+ AADS+++P+QCE+FALEG+S+LL T+  ++  +N +L+I+G 
Sbjct: 122 ILIDCSPSLGLITINALTAADSVIIPVQCEYFALEGISKLLNTIRIIKTKLNPSLEIEGF 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTMFDSR  L+ Q+  +V+++    V+ T+I RNV++SEAPS+G PAI+YD    G++ 
Sbjct: 182 LLTMFDSRLRLANQIYDEVKRHFQELVFKTIIQRNVKLSEAPSHGIPAILYDADSTGAKN 241

Query: 247 YLKLASELIQQER 259
           +L LA+E+I + +
Sbjct: 242 HLALANEIINKNK 254


>gi|116334624|ref|YP_796151.1| chromosome partitioning ATPase [Lactobacillus brevis ATCC 367]
 gi|116099971|gb|ABJ65120.1| chromosome segregation ATPase [Lactobacillus brevis ATCC 367]
          Length = 255

 Score =  244 bits (624), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 121/248 (48%), Positives = 174/248 (70%), Gaps = 1/248 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           II +ANQKGGVGKTTT +NL  ALA+ G+ VLL+D D QGNA++G+GI+    +   YD+
Sbjct: 4   IIALANQKGGVGKTTTGVNLGAALASAGKRVLLVDTDAQGNATSGVGIQKATIEREIYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           L+ E  I + ++QT  P+L I+P+T+ L G E+ L     R  RL  AL  ++   + YI
Sbjct: 64  LVNETPIKEAILQTEHPDLDIVPATIQLSGAEIELTPMMARETRLKAALD-EVRDQYDYI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  AADSIL+P+Q E++ALEGL+QLL TV+ V++  N  L I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTAADSILIPVQSEYYALEGLTQLLNTVKLVQKHFNRNLKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LT++D+R +L +QV  +V+K    KVY T+IPRNV+++EAPS+G P I Y  K  G++ Y
Sbjct: 183 LTLYDARTNLGKQVNEEVKKYFQNKVYATIIPRNVQLAEAPSHGMPIIDYAPKSKGAEVY 242

Query: 248 LKLASELI 255
            +LA E++
Sbjct: 243 SELAKEVL 250


>gi|227873158|ref|ZP_03991449.1| chromosome partitioning protein transcriptional regulator
           [Oribacterium sinus F0268]
 gi|227840989|gb|EEJ51328.1| chromosome partitioning protein transcriptional regulator
           [Oribacterium sinus F0268]
          Length = 254

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 181/253 (71%), Gaps = 3/253 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++IITIANQKGGVGKTTTA+NL+ +LA   + VLL+D DPQGNA +G+GI   + + S Y
Sbjct: 2   AKIITIANQKGGVGKTTTAVNLAASLAEAKQKVLLLDFDPQGNAGSGIGIR--EEEISIY 59

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            +L  E  I + +++ A+ NL  I +  +L  ++  L  E+++ F L +AL   +  D+ 
Sbjct: 60  RILSGEFPIEKGIVREALENLDFIAADRNLSAMDAELAEEENKNFLLKEALE-NIQKDYD 118

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YIF+DCPPS   LT+NA+ A+ S+L+P+QCE++ALEGLSQ+ +T+  V+  +N  L I+G
Sbjct: 119 YIFIDCPPSLGTLTVNALTASHSVLIPIQCEYYALEGLSQMTDTISMVKDALNPDLTIEG 178

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+DSRN LSQ+VV  V+++    ++ T+IPRNVR++EAPS+G P  +YD    G++
Sbjct: 179 ILFTMYDSRNLLSQEVVKAVQEHFSDPIFKTIIPRNVRLAEAPSHGLPISLYDNSSTGAE 238

Query: 246 AYLKLASELIQQE 258
           AY KLA+E+++++
Sbjct: 239 AYRKLAAEILEKD 251


>gi|331007809|ref|ZP_08330914.1| Chromosome (plasmid) partitioning protein ParA [gamma
           proteobacterium IMCC1989]
 gi|330418376|gb|EGG92937.1| Chromosome (plasmid) partitioning protein ParA [gamma
           proteobacterium IMCC1989]
          Length = 260

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/259 (45%), Positives = 181/259 (69%), Gaps = 2/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++I  IANQKGGVGKTTT +NL+ +L AI + VLLID+DPQGNA+ G G+   D   S Y
Sbjct: 2   NKIYAIANQKGGVGKTTTCVNLAASLVAIKKRVLLIDIDPQGNATMGSGVNKSDVPLSIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D+L+E+  I      +   N S+I +  DL   E+ L    ++ FRL  AL+V +   + 
Sbjct: 62  DVLVEDCLIADAQQLSPSGNFSVIAANDDLTAAEVQLLDLPEKQFRLRNALAV-VKDQYD 120

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS N+LT+NA+AA D +++P+QCE+++LEG+S L++T+ ++++ +N +L I+G
Sbjct: 121 YILIDCPPSLNMLTLNALAACDGVIIPMQCEYYSLEGISALMKTINQIQQQLNPSLSIEG 180

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           I+ TM+D R++L+  V   +++  G K+Y T IPRNVR++EAPS+G+PA+IYD +  G+ 
Sbjct: 181 IVRTMYDPRSTLTNDVSDQLKEYFGDKLYQTCIPRNVRLAEAPSFGQPALIYDRQSKGAI 240

Query: 246 AYLKLASELIQQ-ERHRKE 263
           AYL LA E +++ ER +K 
Sbjct: 241 AYLALAGEFVRRSERAQKH 259


>gi|329894821|ref|ZP_08270621.1| sporulation initiation inhibitor protein Soj [gamma proteobacterium
           IMCC3088]
 gi|328922715|gb|EGG30049.1| sporulation initiation inhibitor protein Soj [gamma proteobacterium
           IMCC3088]
          Length = 258

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 176/252 (69%), Gaps = 1/252 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT +NL+ +LAA+   VLLIDLDPQGNA+ G G+  ++   +  D
Sbjct: 3   QIIAIANQKGGVGKTTTCVNLAASLAAMKRRVLLIDLDPQGNATMGSGVNKHEIDLTVCD 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           +L+    I + + ++ +    ++P+  DL   ++ L GE  R  RL K+L  ++   + Y
Sbjct: 63  VLLNRVEITKAIARSEVARFDVLPANSDLTEADVKLMGEIGRDSRLRKSLQ-KIQDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DCPP+  +LT+N + AA+ I++ +QCE+FALEGLS LLET++ V+  +N  LDI GI
Sbjct: 122 ILIDCPPTLTMLTVNGLVAANGIIIAMQCEYFALEGLSDLLETIDGVKEHLNPTLDIVGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           + TMFD R SL+  V + + +  G KV+ TV+PRNVR++EAPS+G PA+ YD + AG++A
Sbjct: 182 LRTMFDPRTSLTNDVSNQLHEFFGPKVFRTVVPRNVRLAEAPSHGLPAMHYDKQSAGAKA 241

Query: 247 YLKLASELIQQE 258
           YL LA+EL++++
Sbjct: 242 YLALAAELVRRQ 253


>gi|269216517|ref|ZP_06160371.1| Soj family protein [Slackia exigua ATCC 700122]
 gi|269130046|gb|EEZ61128.1| Soj family protein [Slackia exigua ATCC 700122]
          Length = 365

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 121/252 (48%), Positives = 173/252 (68%), Gaps = 1/252 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           ++++ I NQKGGVGK+TTAINLS AL   G+ VLL+DLDPQGN S+GLGIE        Y
Sbjct: 114 TKVLAIINQKGGVGKSTTAINLSAALGEKGKQVLLVDLDPQGNTSSGLGIEKGKLDACIY 173

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
           D++I    I  I+I   +  + + P+T++L G E+ L  +  R  RL +A+   +   + 
Sbjct: 174 DVIINGDPITDIIIPDVVEGVDVAPATINLAGAEVELVSQMARENRLKEAV-WPMRGKYD 232

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  LLT+NA+ AAD +L+P+QCEF+ALEG+++LLE+++ V+  +N +LDI G
Sbjct: 233 YILIDCPPSLGLLTVNALVAADKLLIPIQCEFYALEGVTKLLESMKRVKTYLNPSLDIFG 292

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           ++LTM D R +LS+QV  +VR   G  V+ T IPR V+ISEAPS+G+P   YD    G+Q
Sbjct: 293 VLLTMIDRRTTLSKQVADEVRGYFGRIVFTTEIPRTVKISEAPSFGQPITQYDPTGKGAQ 352

Query: 246 AYLKLASELIQQ 257
           AY  LA E+I++
Sbjct: 353 AYSSLAEEVIRR 364


>gi|78189759|ref|YP_380097.1| ParaA family ATPase [Chlorobium chlorochromatii CaD3]
 gi|78171958|gb|ABB29054.1| chromosome segregation ATPase [Chlorobium chlorochromatii CaD3]
          Length = 265

 Score =  244 bits (623), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 114/253 (45%), Positives = 183/253 (72%), Gaps = 2/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDR-KYSSY 65
           R+I IANQKGGVGKTTT++N++ ++A      LLID+DPQ NA++G G+E+ D    + Y
Sbjct: 3   RVIAIANQKGGVGKTTTSVNIAASIAISEFKTLLIDIDPQANATSGFGLEVNDEIDNTFY 62

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
            ++++  NI   +  +++  L ++PS ++L+G+E+ L   +DR + + KAL  ++ + + 
Sbjct: 63  QVMVKGGNIEDAIRPSSLDYLDVLPSNVNLVGMEVELVNMRDREYVMQKALK-EIRNRYD 121

Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185
           YI +DCPPS  L+T+N++ AADS+L+P+Q E++ALEGL +LL T+  VR+ +N  L+I+G
Sbjct: 122 YIIIDCPPSLGLITLNSLTAADSVLIPVQAEYYALEGLGKLLNTISIVRKHLNPKLEIEG 181

Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245
           +++TM+D+R  L+ QV  +V+K    KVY T I RNVR+SEAPS+GKPA++YD +C GS+
Sbjct: 182 VLVTMYDARLRLAAQVAEEVKKFFKDKVYKTYIRRNVRLSEAPSHGKPALLYDAQCIGSK 241

Query: 246 AYLKLASELIQQE 258
            YL LA E+ +++
Sbjct: 242 DYLDLAQEIFEKD 254


>gi|255034021|ref|YP_003084642.1| Cobyrinic acid ac-diamide synthase [Dyadobacter fermentans DSM
           18053]
 gi|254946777|gb|ACT91477.1| Cobyrinic acid ac-diamide synthase [Dyadobacter fermentans DSM
           18053]
          Length = 262

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 181/251 (72%), Gaps = 1/251 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           ++I IANQKGGVGKTTTAINL+ +LAA+    L+ID DPQ N+++GLG    + + S Y+
Sbjct: 3   KVIAIANQKGGVGKTTTAINLAASLAALEFRTLIIDADPQANSTSGLGFNPQEMENSIYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
            ++E+   ++I++QT  PNL+++PS +DL+G E+ +   K+R  R+  A++ ++  D+ +
Sbjct: 63  CMVEQAKTSEIILQTDFPNLNLLPSHIDLVGAEIEMINLKNREHRMKDAIA-EVRDDYDF 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+N++ AADS+++P+QCE+FALEGL +LL T+  ++  +N+ L I+GI
Sbjct: 122 IIIDCSPSLGLITINSLTAADSVIIPVQCEYFALEGLGKLLNTITIIQSRLNTNLIIEGI 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D R  LS QVV++V  +    V+NT+IPRNVRISEAPS+G P +  D    G+ +
Sbjct: 182 LLTMYDLRLRLSNQVVTEVTNHFESLVFNTIIPRNVRISEAPSFGIPVMAQDSDSKGAVS 241

Query: 247 YLKLASELIQQ 257
           YL LA E++ +
Sbjct: 242 YLNLAREILSK 252


>gi|254458906|ref|ZP_05072329.1| cobyrinic Acid a,c-diamide synthase [Campylobacterales bacterium GD
           1]
 gi|207084177|gb|EDZ61466.1| cobyrinic Acid a,c-diamide synthase [Campylobacterales bacterium GD
           1]
          Length = 260

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 182/259 (70%), Gaps = 10/259 (3%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           S +I IANQKGGVGKTTTA+NL+ +LA   + VLLID DPQ NA+T LG    D +++ Y
Sbjct: 2   SEVIVIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDADPQANATTSLGFHRNDYEFNIY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIE--MILGGEKD-RLFRLDKALSVQLTS 122
            +LI  K +  I++++ +P L + PS + L+GIE        KD R   L +A++  +  
Sbjct: 62  HVLIGTKKLKDIILKSDLPTLHLAPSNIGLVGIEKEYYDNNNKDGRELVLKRAIA-NVQK 120

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           D+ YI +D PP+   +T+NA++A++S+++P+QCEFFALEGL+QLL TV+ VR+++N +L 
Sbjct: 121 DYDYIIIDSPPALGPMTINALSASNSVIIPIQCEFFALEGLAQLLNTVKLVRKSINPSLS 180

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYN------TVIPRNVRISEAPSYGKPAII 236
           I+G + TMF S+N+LS+QV +D+ ++  GK++        V+PRNV+++EAPS+GKPAI+
Sbjct: 181 IKGFLPTMFSSQNNLSKQVFADLSQHFNGKLFKDQKNKYIVVPRNVKLAEAPSFGKPAIL 240

Query: 237 YDLKCAGSQAYLKLASELI 255
           YD+K  GS AY  LA  +I
Sbjct: 241 YDVKSVGSIAYQNLAQTII 259


>gi|72163510|ref|YP_291167.1| chromosome segregation ATPase [Thermobifida fusca YX]
 gi|71917242|gb|AAZ57144.1| chromosome segregation ATPase [Thermobifida fusca YX]
          Length = 345

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 170/261 (65%), Gaps = 1/261 (0%)

Query: 4   KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYS 63
           ++ RII++ANQKGGVGKTTT +NL+ ALA     VL++DLDPQGNAST LG+E      S
Sbjct: 83  ERCRIISVANQKGGVGKTTTTVNLAVALAMHNNRVLVVDLDPQGNASTALGMERSPESRS 142

Query: 64  SYDLLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
            Y  L+E++ +  +      +PNL  +P+T+DL G E+ L     R  RL +A      S
Sbjct: 143 IYHCLVEDEELRALERPVPGVPNLRCVPATIDLAGAEIELVSLVARESRLKRAFEAYDVS 202

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
           +  YI +DCPPS  LLT+NAM A + +L+P+QCE++ALEG+ QLL+ +E V+  +N  L 
Sbjct: 203 ELDYILIDCPPSLGLLTVNAMVACEEVLIPIQCEYYALEGVGQLLKNIELVKSHLNPGLF 262

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
           I  ++LTM+D R  L+ QV  +VR + G  V  T+IPR+VR+SEAPSYG+  + YD   +
Sbjct: 263 ISTVLLTMYDGRTRLAAQVAEEVRSHFGDVVLRTMIPRSVRVSEAPSYGQSVMTYDPGSS 322

Query: 243 GSQAYLKLASELIQQERHRKE 263
           G+ AYL  A EL  + + R E
Sbjct: 323 GAMAYLDAARELAFRAQSRVE 343


>gi|256820393|ref|YP_003141672.1| Cobyrinic acid ac-diamide synthase [Capnocytophaga ochracea DSM
           7271]
 gi|315223447|ref|ZP_07865304.1| sporulation initiation inhibitor protein Soj [Capnocytophaga
           ochracea F0287]
 gi|256581976|gb|ACU93111.1| Cobyrinic acid ac-diamide synthase [Capnocytophaga ochracea DSM
           7271]
 gi|314946620|gb|EFS98611.1| sporulation initiation inhibitor protein Soj [Capnocytophaga
           ochracea F0287]
          Length = 256

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 179/253 (70%), Gaps = 1/253 (0%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           +II IANQKGGVGKTTT++NL+ AL  + + VLLID DPQ NA++G+GI++   ++ +Y+
Sbjct: 3   KIIAIANQKGGVGKTTTSVNLAAALGVLEKKVLLIDADPQANATSGIGIDVDSIEHGTYE 62

Query: 67  LLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSY 126
           LL        +++ T+ PNL +I + ++L+ IE+ L  ++ R + L KAL   +   + Y
Sbjct: 63  LLEHTMEAKDMIVHTSSPNLDLIAAHINLVAIEIELVDKEQREYMLKKALE-PIKDQYDY 121

Query: 127 IFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGI 186
           I +DC PS  L+T+NA+ AA+S+++P+QCE+FALEGL +LL T++ V++T N  LDI+G+
Sbjct: 122 ILIDCAPSLGLITLNALTAANSVIIPIQCEYFALEGLGKLLNTIKSVQKTFNPNLDIEGL 181

Query: 187 ILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQA 246
           +LTM+D+R  LS QVV +V+K+    V+ T+I RNVR+SEAPS+G+  I YD    G+  
Sbjct: 182 LLTMYDARLRLSNQVVEEVQKHFSDMVFKTIIQRNVRLSEAPSFGETIINYDATSKGATN 241

Query: 247 YLKLASELIQQER 259
           ++ LA E+I + +
Sbjct: 242 HINLAQEIIDKNK 254


>gi|227506193|ref|ZP_03936242.1| chromosome partitioning protein transcriptional regulator
           [Corynebacterium striatum ATCC 6940]
 gi|227197217|gb|EEI77265.1| chromosome partitioning protein transcriptional regulator
           [Corynebacterium striatum ATCC 6940]
          Length = 282

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 170/260 (65%), Gaps = 3/260 (1%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYD 66
           R+ITIANQKGGVGKTT+A+NL+ ALA  G+ VL+IDLDPQGNAST +G        SSY+
Sbjct: 5   RLITIANQKGGVGKTTSAVNLAAALAEAGKKVLVIDLDPQGNASTAVGAAHTSGTDSSYE 64

Query: 67  LLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD-- 123
           +L+ ++   Q +  +   PNL  IP+T+DL G E+ +     R FRL  AL      +  
Sbjct: 65  VLLGDRTAEQAMQPSPGSPNLFCIPATIDLAGAEIEMVSLVRREFRLYDALHNGFLEEHG 124

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           F Y+F+DCPPS  LLT+NAM  A+ +++P+QCE++ALEG+ QLL  +  +R  +N  L I
Sbjct: 125 FEYVFIDCPPSLGLLTINAMTCAEEVIIPIQCEYYALEGVGQLLGNISMIREHLNEELHI 184

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
             ++LTM+D+R  L++QV S+VR+  G  V   VIPR+VR+SEAP YGK  I YD    G
Sbjct: 185 SAVLLTMYDARTKLAEQVASEVREQFGAVVLGNVIPRSVRVSEAPGYGKTVIQYDPTSTG 244

Query: 244 SQAYLKLASELIQQERHRKE 263
           ++AY   A EL  +  +R  
Sbjct: 245 ARAYSAAARELNSRGDYRPH 264


>gi|283852488|ref|ZP_06369756.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio sp. FW1012B]
 gi|283572096|gb|EFC20088.1| Cobyrinic acid ac-diamide synthase [Desulfovibrio sp. FW1012B]
          Length = 258

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 120/255 (47%), Positives = 176/255 (69%), Gaps = 5/255 (1%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSS- 64
           +R+I IANQKGGVGKTTTA+NL+ +LA + +  LLID DPQ NA +GL I  Y  K +  
Sbjct: 2   ARVIVIANQKGGVGKTTTAVNLAASLAVMEKKTLLIDCDPQANAGSGLSI--YSDKIAET 59

Query: 65  -YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123
            Y +L E +   + ++ T +P LS++PS  DL+  ++ L  +  R + L +AL   L  D
Sbjct: 60  LYTVLYEPERAAEAVVCTELPFLSVLPSGPDLVAADIELVAKPRREYFL-RALVDTLAGD 118

Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183
           + YI LDCPPS  L+T+NA+ AA  +LVPLQCE++ALEG++QLL T ++VR+  N+ L +
Sbjct: 119 YDYILLDCPPSLGLVTLNALCAATELLVPLQCEYYALEGIAQLLRTYDQVRKRFNNRLKL 178

Query: 184 QGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAG 243
            G++LTM+D RN L++ V  +V K      + T+IPRN+R+SEAPSYGKP + +D+K  G
Sbjct: 179 LGVVLTMYDGRNKLNRHVKREVWKCFPKLYFQTLIPRNIRLSEAPSYGKPVLTHDIKSRG 238

Query: 244 SQAYLKLASELIQQE 258
           ++AYL LA E++++ 
Sbjct: 239 AEAYLSLAQEVVRRR 253


>gi|256848573|ref|ZP_05554014.1| chromosome segregation ATPase [Lactobacillus coleohominis
           101-4-CHN]
 gi|256714625|gb|EEU29605.1| chromosome segregation ATPase [Lactobacillus coleohominis
           101-4-CHN]
          Length = 256

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/248 (48%), Positives = 173/248 (69%), Gaps = 1/248 (0%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I +ANQKGGVGKTTT++NL   LA  G+ VLLIDLDPQGNA++GLGI+    + S YD+
Sbjct: 4   VIALANQKGGVGKTTTSVNLGACLADAGKRVLLIDLDPQGNATSGLGIDKKKIEQSVYDV 63

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
           LI +  ++ ++  ++   L I P+T++L G E+ L     R  RL    +  +   + YI
Sbjct: 64  LINDVELSAVIQPSSHQGLDIAPTTIELSGAEVELTSMMARETRLKDGFA-DVQDQYDYI 122

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +DCPPS  LLT+NA  AA+SIL+P+Q E++ALEGLSQL+ T++ VR+  N  L I+G++
Sbjct: 123 LIDCPPSLGLLTINAFTAANSILIPVQSEYYALEGLSQLINTIQLVRKHFNKDLKIEGVL 182

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           LTMFD R +L Q+V ++V+K  G +VY TVIPRNVR+SEAPS+G   I YD +  G++ Y
Sbjct: 183 LTMFDKRTNLGQEVNAEVKKFFGSQVYETVIPRNVRLSEAPSHGLAIIDYDKRSTGAKVY 242

Query: 248 LKLASELI 255
            +LA E++
Sbjct: 243 QQLAKEVL 250


>gi|317486056|ref|ZP_07944909.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Bilophila wadsworthia 3_1_6]
 gi|316922683|gb|EFV43916.1| CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
           [Bilophila wadsworthia 3_1_6]
          Length = 262

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 173/259 (66%), Gaps = 1/259 (0%)

Query: 6   SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSY 65
           +RII IANQKGGVGKTTTAINL+ +LA + + VLL+D DPQ N ++GLG        + Y
Sbjct: 2   ARIIAIANQKGGVGKTTTAINLAASLAIMEKRVLLVDCDPQANTTSGLGFGQDVLPANLY 61

Query: 66  DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFS 125
               + + +N+ ++ T  P L ++PS  DL   E+ L  +  R F