RPSBLAST alignment for GI: 254780806 and conserved domain: PRK13869

>gnl|CDD|139929 PRK13869, PRK13869, plasmid-partitioning protein RepA; Provisional. Length = 405
 Score = 84.3 bits (208), Expect = 3e-17
 Identities = 59/240 (24%), Positives = 115/240 (47%), Gaps = 20/240 (8%)

Query: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLG------IELYDR 60
           ++I + N KGG GKTTT+ +L+  LA  G  VL +DLDPQ + S  LG      +   + 
Sbjct: 122 QVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDPQASLSALLGVLPETDVGANET 181

Query: 61  KYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIE------MILGGEKDRLF--RL 112
            Y++       + +  ++  T    L ++P  ++L+  E      +   G +D LF  R+
Sbjct: 182 LYAAIRYDDTRRPLRDVIRPTYFDGLHLVPGNLELMEFEHTTPKALSDKGTRDGLFFTRV 241

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
            +A   ++  D+  + +DCPP    LT++ + AA S+++ +  +   +  +SQ L    +
Sbjct: 242 AQAFD-EVADDYDVVVIDCPPQLGFLTLSGLCAATSMVITVHPQMLDIASMSQFLLMTRD 300

Query: 173 VRRTVNSA-----LDIQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEA 227
           +   V  A      D    +LT ++ +++   +V + +R      V    + ++  +S+A
Sbjct: 301 LLGVVKEAGGNLQYDFIRYLLTRYEPQDAPQTKVAALLRNMFEDHVLTNPMVKSAAVSDA 360