RPSBLAST alignment for GI: 254780806 and conserved domain: PRK13705

>gnl|CDD|184261 PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional. Length = 388
 Score = 75.8 bits (186), Expect = 1e-14
 Identities = 69/233 (29%), Positives = 110/233 (47%), Gaps = 30/233 (12%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLID-LDPQGNASTGLGIELYDRKYSSYD 66
           +I +A  KGGV KT+ +++L+  LA  G  VLL++  DPQG AS   G  + D    + D
Sbjct: 108 VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGW-VPDLHIHAED 166

Query: 67  LLI-----EEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDR---------LFRL 112
            L+     E+ +    +  T  P L IIPS + L  IE  L G+ D          + RL
Sbjct: 167 TLLPFYLGEKDDATYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLRL 226

Query: 113 DKALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEE 172
             A+   +  D+  I +D  P+  + T+N + AAD ++VP   E F      Q  + + +
Sbjct: 227 --AIE-TVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRD 283

Query: 173 VRRTVNSALDIQG------IILTMFDSRN-SLSQQVVSDVRKNLGGKVYNTVI 218
           + + V    D++G      I+LT + + N S S  +   +R   G  V   V+
Sbjct: 284 LLKNV----DLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVV 332