RPSBLAST alignment for GI: 254780806 and conserved domain: COG0003

>gnl|CDD|30352 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 322
 Score = 51.5 bits (123), Expect = 2e-07
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 9/134 (6%)

Query: 15  KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL-YDRKYSSYDLLIEEKN 73
           KGGVGKTT A   +  LA  G+ VLL+  DP  +      +EL +D +    +L   E +
Sbjct: 10  KGGVGKTTIAAATAVKLAESGKKVLLVSTDPAHSLGDVFDLELGHDPRKVGPNLDALELD 69

Query: 74  INQIL---IQTAIPNLSIIPSTMDLLGIEM----ILGGEKDRLFRLDKALSVQLTSDFSY 126
             + L          L+ +  T  L GI       L G  D    L K L   ++ ++  
Sbjct: 70  PEKALEEYWDEVKDYLARLLRTRGLGGIYADELATLPG-IDEALALLKILEYYVSGEYDV 128

Query: 127 IFLDCPPSFNLLTM 140
           I +D  P+ + L +
Sbjct: 129 IVVDTAPTGHTLRL 142