RPSBLAST alignment for GI: 254780806 and conserved domain: COG0455

>gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 262
 Score =  100 bits (250), Expect = 5e-22
 Identities = 62/254 (24%), Positives = 117/254 (46%), Gaps = 16/254 (6%)

Query: 5   KSRIITIANQKGGVGKTTTAINLSTALAAI-GENVLLIDLDPQ-GNASTGLGIELYDRKY 62
            +++I + + KGGVGKTT   NL  ALAA+ G+ VLLID D   GN S  LG+E   +  
Sbjct: 1   MTKVIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVE--SKPT 58

Query: 63  SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122
           + +D+L  E +I  I+ +T    L ++P    L  +  +   + + + +       +L  
Sbjct: 59  TLHDVLAGEASIEDIIYETPQDGLYVLPGGSGLEDLAKLDPEDLEDVIK-------ELEE 111

Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182
            + YI +D     +  T++ + ++D +++    E  ++    + ++ +      +   L 
Sbjct: 112 LYDYILIDTGAGLSRDTLSFILSSDELVIVTTPEPTSITDAYKTIKIL----SKLGLDLL 167

Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242
            + ++L    S           ++      V   VIP +  +  A + GKP ++Y     
Sbjct: 168 GRRVVLNRVRSTKEGVDVAALLIQVVKQVPVLQ-VIPFDPEVRRALAEGKPIVLYSPNSK 226

Query: 243 GSQAYLKLASELIQ 256
            SQA  +LA++L  
Sbjct: 227 ASQAIKELAAKLAG 240