RPSBLAST alignment for GI: 254780806 and conserved domain: cd02036

>gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.. Length = 179
 Score = 78.3 bits (193), Expect = 2e-15
 Identities = 58/240 (24%), Positives = 92/240 (38%), Gaps = 61/240 (25%)

Query: 8   IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67
           +I + + KGGVGKTTT  NL TALA +G  V+LID D                       
Sbjct: 1   VIVVTSGKGGVGKTTTTANLGTALAQLGYKVVLIDADL---------------------- 38

Query: 68  LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127
                          + NL             +ILG E   ++ L   L+        YI
Sbjct: 39  --------------GLRNLD------------LILGLENRVVYTLHDVLAGD------YI 66

Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187
            +D P       + A+A AD  L+    E  +L    ++   +E +       + + G+I
Sbjct: 67  LIDSPAGIERGFITAIAPADEALLVTTPEISSLRDADRVKGLLEAL------GIKVVGVI 120

Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247
           +            +V D+ + LG  +   VIP +  +  A + G+P ++   K   +QAY
Sbjct: 121 VNRVRPDMVEGGDMVEDIEEILGVPLLG-VIPEDPAVIRATNRGEPVVLNKPKSPAAQAY 179