RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780806|ref|YP_003065219.1| chromosome partitioning protein A [Candidatus Liberibacter asiaticus str. psy62] (265 letters) >gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 259 Score = 220 bits (560), Expect = 4e-58 Identities = 112/261 (42%), Positives = 158/261 (60%), Gaps = 4/261 (1%) Query: 5 KSRIITIANQKGGVGKTTTAINLSTALA-AIGENVLLIDLDPQGNASTGLGIELYDRKYS 63 +II +ANQKGGVGKTTTA+NL+ ALA G+ VLLIDLDPQG+ ++ LG+ D + Sbjct: 1 MMKIIAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQGSLTSWLGLRP-DLEGD 59 Query: 64 SYDLLIEEKNINQILIQT-AIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122 Y+LL K IL T I L +IPS +DL I + L + L + Sbjct: 60 LYNLLSGLKERPDILDYTVVIEGLDLIPSNIDLAEGAEIELNAVAKELLLKRLLD-PVKD 118 Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182 D+ YI +D PPS +LT+NA+AAAD +L+P+Q EF LEGL QLL T+E++ + + L Sbjct: 119 DYDYIIIDTPPSLGVLTLNALAAADHVLIPVQPEFLDLEGLEQLLNTLEDLLKLRRNKLI 178 Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242 + GI++T FDSR L+ +V+ ++++ LG V T IPR V EA + GKP YD K Sbjct: 179 VVGILITRFDSRTKLADEVLQELKQLLGDPVLKTKIPRRVAYREAAAEGKPLYEYDPKSK 238 Query: 243 GSQAYLKLASELIQQERHRKE 263 ++ Y +LA EL+++ K Sbjct: 239 AAEEYYELAKELLEELLKLKP 259 >gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain. This family consists of various cobyrinic acid a,c-diamide synthases. These include CbiA and CbiP from S.typhimurium, and CobQ from R. capsulatus. These amidases catalyse amidations to various side chains of hydrogenobyrinic acid or cobyrinic acid a,c-diamide in the biosynthesis of cobalamin (vitamin B12) from uroporphyrinogen III. Vitamin B12 is an important cofactor and an essential nutrient for many plants and animals and is primarily produced by bacteria. The family also contains dethiobiotin synthetases as well as the plasmid partitioning proteins of the MinD/ParA family. Length = 212 Score = 142 bits (359), Expect = 1e-34 Identities = 78/228 (34%), Positives = 112/228 (49%), Gaps = 26/228 (11%) Query: 9 ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGN--ASTGLGIELYDR-KYSSY 65 I IA KGGVGKTT A NL+ ALA G VLLIDLDPQ N +S G G +L D K Sbjct: 1 IAIAGTKGGVGKTTLAANLARALAKRGYRVLLIDLDPQANLTSSLGKGPDLIDVLKEGLE 60 Query: 66 DLLIEEKNINQILIQT--AIPNLSIIPSTMDLLG--IEMILGGEKDRLFRLDKALSVQLT 121 + + I + L +IPS + L E+IL G ++ L +L Sbjct: 61 IVDAQPLQHIAAAIVPSRNLDPLLLIPSNLSLANFESELILEGGEEGLIKL--------- 111 Query: 122 SDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSAL 181 + Y+ +D P LT NA+ AAD ++VP++ E A+ G +LLE VE + L Sbjct: 112 -AYDYVIIDGAPGLGELTANALVAADILVVPIEPEGVAVLGAQRLLELVERLG------L 164 Query: 182 DIQGIILTMFDSRN-SLSQQVVSDVRKNLGG--KVYNTVIPRNVRISE 226 I G++L D + + + + + G + VIPR++ +SE Sbjct: 165 KILGVVLNKVDRGDERHLDKEIEALERKTGIPVLLLLGVIPRDLALSE 212 >gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 262 Score = 100 bits (250), Expect = 5e-22 Identities = 62/254 (24%), Positives = 117/254 (46%), Gaps = 16/254 (6%) Query: 5 KSRIITIANQKGGVGKTTTAINLSTALAAI-GENVLLIDLDPQ-GNASTGLGIELYDRKY 62 +++I + + KGGVGKTT NL ALAA+ G+ VLLID D GN S LG+E + Sbjct: 1 MTKVIAVVSGKGGVGKTTITANLGAALAALGGKVVLLIDADLGLGNLSLLLGVE--SKPT 58 Query: 63 SSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTS 122 + +D+L E +I I+ +T L ++P L + + + + + + +L Sbjct: 59 TLHDVLAGEASIEDIIYETPQDGLYVLPGGSGLEDLAKLDPEDLEDVIK-------ELEE 111 Query: 123 DFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182 + YI +D + T++ + ++D +++ E ++ + ++ + + L Sbjct: 112 LYDYILIDTGAGLSRDTLSFILSSDELVIVTTPEPTSITDAYKTIKIL----SKLGLDLL 167 Query: 183 IQGIILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCA 242 + ++L S ++ V VIP + + A + GKP ++Y Sbjct: 168 GRRVVLNRVRSTKEGVDVAALLIQVVKQVPVLQ-VIPFDPEVRRALAEGKPIVLYSPNSK 226 Query: 243 GSQAYLKLASELIQ 256 SQA +LA++L Sbjct: 227 ASQAIKELAAKLAG 240 >gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal role, selecting the mid-cell over other sites through the activation and regulation of MinC and MinE. MinD is a membrane-associated ATPase, related to nitrogenase iron protein. More distantly related proteins include flagellar biosynthesis proteins and ParA chromosome partitioning proteins. MinD is a monomer.. Length = 179 Score = 78.3 bits (193), Expect = 2e-15 Identities = 58/240 (24%), Positives = 92/240 (38%), Gaps = 61/240 (25%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDL 67 +I + + KGGVGKTTT NL TALA +G V+LID D Sbjct: 1 VIVVTSGKGGVGKTTTTANLGTALAQLGYKVVLIDADL---------------------- 38 Query: 68 LIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYI 127 + NL +ILG E ++ L L+ YI Sbjct: 39 --------------GLRNLD------------LILGLENRVVYTLHDVLAGD------YI 66 Query: 128 FLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGII 187 +D P + A+A AD L+ E +L ++ +E + + + G+I Sbjct: 67 LIDSPAGIERGFITAIAPADEALLVTTPEISSLRDADRVKGLLEAL------GIKVVGVI 120 Query: 188 LTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAY 247 + +V D+ + LG + VIP + + A + G+P ++ K +QAY Sbjct: 121 VNRVRPDMVEGGDMVEDIEEILGVPLLG-VIPEDPAVIRATNRGEPVVLNKPKSPAAQAY 179 >gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]. Length = 272 Score = 75.2 bits (185), Expect = 2e-14 Identities = 73/264 (27%), Positives = 124/264 (46%), Gaps = 23/264 (8%) Query: 6 SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLD-PQGNASTGLGIELYDRK--Y 62 +RII + + KGGVGKTTT N+ TALA +G+ V+LID D N +G+E + Y Sbjct: 2 ARIIVVTSGKGGVGKTTTTANIGTALAQLGKKVVLIDFDIGLRNLDLIMGLE---NRIVY 58 Query: 63 SSYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFR--LDKALSVQ 119 D++ E +NQ LI+ + NL ++P++ +KD L + K ++ Sbjct: 59 DLVDVIEGEATLNQALIKDKRLENLFLLPASQT---------RDKDALTPEGVKKVVNEL 109 Query: 120 LTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVE-EVRRTVN 178 DF YI +D P NA+ AD +V E ++ +++ +E + RR Sbjct: 110 KAMDFDYIIIDSPAGIEQGFKNAVYFADEAIVVTNPEVSSVRDSDRIIGLLESKSRRAEI 169 Query: 179 SALDIQGIILTMFDSRNSLSQQVVS--DVRKNLGGKVYNTVIPRNVRISEAPSYGKPAII 236 + ++L + +++S DV + L + VIP + + A + G+P +I Sbjct: 170 GEEPKEHLLLNRYRPEMVKRGEMLSVEDVLEILSIPLIG-VIPEDQDVLRASNKGEP-VI 227 Query: 237 YDLKCAGSQAYLKLASELIQQERH 260 D +AY +A L+ +E Sbjct: 228 LDDNSDAGKAYRDIARRLLGEEVP 251 >gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in R. etli Sym plasmid. This operon is involved in the plasmid replication and partition.. Length = 104 Score = 71.4 bits (175), Expect = 2e-13 Identities = 29/39 (74%), Positives = 34/39 (87%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQ 46 +I +ANQKGGVGKTTTA+NL+ ALA G+ VLLIDLDPQ Sbjct: 1 VIAVANQKGGVGKTTTAVNLAAALARRGKRVLLIDLDPQ 39 Score = 68.4 bits (167), Expect = 2e-12 Identities = 34/76 (44%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Query: 114 KALSVQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEV 173 + L + L + YI +D PPS LLT NA+AAAD +L+P+Q L+GL +LLET + Sbjct: 30 RVLLIDLDPQYDYIIIDTPPSLGLLTRNALAAADLVLIPVQPSPLDLDGLEKLLET-LIL 88 Query: 174 RRTVNSALDIQGIILT 189 +N LDI GI+ T Sbjct: 89 EDRLNPDLDILGILPT 104 >gnl|CDD|164554 CHL00175, minD, septum-site determining protein; Validated. Length = 281 Score = 61.7 bits (150), Expect = 2e-10 Identities = 50/153 (32%), Positives = 78/153 (50%), Gaps = 12/153 (7%) Query: 2 EEKKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLD-PQGNASTGLGIELYDR 60 SRII I + KGGVGKTTT NL ++A +G V LID D N LG+E +R Sbjct: 11 SATMSRIIVITSGKGGVGKTTTTANLGMSIARLGYRVALIDADIGLRNLDLLLGLE--NR 68 Query: 61 -KYSSYDLLIEEKNINQILIQTA-IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSV 118 Y++ D+L E ++Q LI+ NLS++ + + + + + L +L Sbjct: 69 VLYTAMDVLEGECRLDQALIRDKRWKNLSLLAISKNRQRYNV----TRKNMNMLVDSLKN 124 Query: 119 QLTSDFSYIFLDCPPSFNLLTMNAMAAADSILV 151 + + YI +DCP ++ +NA+A A +V Sbjct: 125 R---GYDYILIDCPAGIDVGFINAIAPAQEAIV 154 >gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 265 Score = 59.3 bits (143), Expect = 1e-09 Identities = 49/190 (25%), Positives = 86/190 (45%), Gaps = 25/190 (13%) Query: 7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQG-NASTGLGIELYDRKYSSY 65 +I + + KGGVGK+T A+NL+ ALA +G+ VLL+D D +G + LG+E Sbjct: 58 NVIAVTSGKGGVGKSTVAVNLAAALAQLGKRVLLLDADLRGPSIPRMLGLENLPGLTE-- 115 Query: 66 DLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGG---EKDRLFRLDKALSVQLTS 122 L+ + + ++ I LSI+P L + +I G K L L+ L Sbjct: 116 --LLAGEALEPVIQHDGIKVLSILP----LGPVPVIPRGLLGSKAMLQLLEDVLW----G 165 Query: 123 DFSYIFLDCPPSFNL--LTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180 ++ Y+ +D PP T+ ++V ALE + + ++ +E+ Sbjct: 166 EYDYVIIDTPPGTGDADATVLQRIPDGVVIVTTP-GKTALEDVKKAIDMLEKAGI----- 219 Query: 181 LDIQGIILTM 190 + G++ M Sbjct: 220 -PVLGVVENM 228 >gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell. This ATP-driven oxyanion pump catalyzes the extrusion of arsenite, antimonite and arsenate. Maintenance of a low intracellular concentration of oxyanion produces resistance to the toxic agents. The pump is composed of two subunits, the catalytic ArsA subunit and the membrane subunit ArsB, which are encoded by arsA and arsB genes respectively. Arsenic efflux in bacteria is catalyzed by either ArsB alone or by ArsAB complex. The ATP-coupled pump, however, is more efficient. ArsA is composed of two homologous halves, A1 and A2, connected by a short linker sequence.. Length = 217 Score = 52.2 bits (125), Expect = 2e-07 Identities = 30/126 (23%), Positives = 44/126 (34%), Gaps = 2/126 (1%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNI 74 KGGVGKTT A + LA G+ VLL+ DP N S L D + Sbjct: 7 KGGVGKTTIAAATAVRLAEEGKKVLLVSTDPAHNLSDKGLPNLSDAFIVEDPEIAPNLYR 66 Query: 75 NQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQLTSDFSYIFLDCPPS 134 ++ + + L + G E+ L L + I D P+ Sbjct: 67 EEVDATRRVERAWGGEGGLMLELAAALPGIEE--LASLLAVFREFSEGLYDVIVFDTAPT 124 Query: 135 FNLLTM 140 + L + Sbjct: 125 GHTLRL 130 >gnl|CDD|30352 COG0003, ArsA, Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 322 Score = 51.5 bits (123), Expect = 2e-07 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 9/134 (6%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL-YDRKYSSYDLLIEEKN 73 KGGVGKTT A + LA G+ VLL+ DP + +EL +D + +L E + Sbjct: 10 KGGVGKTTIAAATAVKLAESGKKVLLVSTDPAHSLGDVFDLELGHDPRKVGPNLDALELD 69 Query: 74 INQIL---IQTAIPNLSIIPSTMDLLGIEM----ILGGEKDRLFRLDKALSVQLTSDFSY 126 + L L+ + T L GI L G D L K L ++ ++ Sbjct: 70 PEKALEEYWDEVKDYLARLLRTRGLGGIYADELATLPG-IDEALALLKILEYYVSGEYDV 128 Query: 127 IFLDCPPSFNLLTM 140 I +D P+ + L + Sbjct: 129 IVVDTAPTGHTLRL 142 >gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]. Length = 300 Score = 50.3 bits (120), Expect = 5e-07 Identities = 59/272 (21%), Positives = 111/272 (40%), Gaps = 44/272 (16%) Query: 6 SRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQG-NASTGLGIELYDRKYSS 64 II + + KGGVGK+T +NL+ ALA+ G+ V L+D D G + +G+E Sbjct: 47 KHIILVLSGKGGVGKSTVTVNLALALASEGKKVGLLDADLCGPSIPRMMGLE-------- 98 Query: 65 YDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDR-LFRLDKALSV--QLT 121 +++ + N ++ NL L+ + +L D ++R K S+ Q Sbjct: 99 GEVVHQSDNGWIPVVVN--KNLK-------LMSMGFLLKPRDDSVIWRGPKKNSMIKQFL 149 Query: 122 SD-----FSYIFLDCPPSFN---LLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEV 173 D Y+ +D PP + L + + +D ++ + A L + +E+ Sbjct: 150 KDVDWGELDYLVIDTPPGTSDEHLSLVQFLRESDGAVIVTTPQEVA------LQDVRKEI 203 Query: 174 RRTVNSALDIQGIILTMF--------DSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRIS 225 + + I G++ M S N + + LG +P + I+ Sbjct: 204 DFCRKAGIPILGVVENMSGFVCPKCGHSTNIFGSGGGERLAEELGLP-LLGSLPLDPLIA 262 Query: 226 EAPSYGKPAIIYDLKCAGSQAYLKLASELIQQ 257 E+ G P + S+A+ +A +L++Q Sbjct: 263 ESSDSGVPFVEEYPDSPASEAFEDIAEKLVEQ 294 >gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions as a Na+/H+ antiporter.. Length = 169 Score = 50.5 bits (121), Expect = 5e-07 Identities = 19/37 (51%), Positives = 27/37 (72%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLD 44 +I + + KGGVGK+T A+NL+ ALA +G V L+D D Sbjct: 1 VIAVMSGKGGVGKSTVAVNLALALAKLGYKVGLLDAD 37 >gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily. It shares the common function as an ATPase, with the ATP-binding domain at the N-terminus. In Pseudomonas aeruginosa, FleN gene is involved in regulating the number of flagella and chemotactic motility by influencing FleQ activity.. Length = 139 Score = 50.1 bits (120), Expect = 7e-07 Identities = 20/37 (54%), Positives = 27/37 (72%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLD 44 II + + KGGVGKT + NL+ ALA +G+ VLL+D D Sbjct: 1 IIAVTSGKGGVGKTNISANLALALAKLGKRVLLLDAD 37 >gnl|CDD|34570 COG4963, CpaE, Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion]. Length = 366 Score = 48.8 bits (116), Expect = 1e-06 Identities = 40/179 (22%), Positives = 80/179 (44%), Gaps = 16/179 (8%) Query: 4 KKSRIITIANQKGGVGKTTTAINLSTALAA-IGENVLLIDLD-PQGNASTGLGIELYDRK 61 ++ R + KGGVG +T A NL+ LA G VLL+DLD G A+ L + Sbjct: 102 QQGRELAFLGAKGGVGTSTLAHNLAKGLAILSGAAVLLVDLDLQGGTAALYLDQDP---A 158 Query: 62 YSSYDLLIEEKNINQILIQTA----IPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALS 117 + + + + + ++Q+L+ + L ++ + +L + G +R L Sbjct: 159 FGIAEAVKQPERLDQVLLDSLLTRLASGLKLLAAPTELAKNYDLKTGAVER-------LL 211 Query: 118 VQLTSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRT 176 L F ++ +D P + T ++ +D I++ + +L +LL+ ++ +R Sbjct: 212 DLLRGSFDFVVVDLPNIWTDWTRQVLSGSDEIVIVAEPSLASLRNAKELLDELKRLRPN 270 >gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.. Length = 99 Score = 47.0 bits (111), Expect = 6e-06 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAIGENVLLID 42 +I + KGGVGKTT A NL+ ALA G+ VLLID Sbjct: 1 VIVVTG-KGGVGKTTLAANLAAALAKRGKRVLLID 34 Score = 33.9 bits (77), Expect = 0.051 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 6/67 (8%) Query: 126 YIFLDCPPSFNLLTM---NAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182 Y+ +D PP LL + A+ AAD +++ E A+ G E V L Sbjct: 36 YVLIDTPPGLGLLVLLCLLALLAADLVIIVTTPEALAVLG---ARRLTEVVLELAIEGLR 92 Query: 183 IQGIILT 189 G+++ Sbjct: 93 PVGVVVN 99 >gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.. Length = 106 Score = 45.7 bits (108), Expect = 1e-05 Identities = 22/40 (55%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Query: 8 IITIANQKGGVGKTTTAINLSTALAAI-GENVLLIDLDPQ 46 +I KGGVG TT A NL+ ALA G VLL+DLD Q Sbjct: 1 VIAFIGAKGGVGATTLAANLAVALAKEAGRRVLLVDLDLQ 40 >gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.. Length = 179 Score = 44.8 bits (106), Expect = 2e-05 Identities = 40/205 (19%), Positives = 73/205 (35%), Gaps = 41/205 (20%) Query: 9 ITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLL 68 I + + KGG GKTT ++ ALAA+ +NV+L D D Sbjct: 2 IAVISGKGGTGKTT----VTAALAALLKNVVLADCD------------------------ 33 Query: 69 IEEKNINQILIQTAIPNLSIIPST-----MDLLGIEMILGGEKDRLFRLDKALSVQLTSD 123 ++ N++ L I L I L G+ R A + Sbjct: 34 VDAPNLHLFLKPEIEEEEDFIVGGKKAVIDPELCISCGLCGKLVTEVR-KHAKEIAKAEG 92 Query: 124 FSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDI 183 I +D PP + ++ AD+ L+ + L L + +E V V Sbjct: 93 AELIIIDGPPGIGCPVIASLTGADAALLVTEPTPSGLHDLERAVELVRHFGIPV------ 146 Query: 184 QGIILTMFDSRNSLSQQVVSDVRKN 208 G+++ +D + +++++ + Sbjct: 147 -GVVINKYDLNDEIAEEIEDYCEEE 170 >gnl|CDD|48371 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase. Members of this family use energey from ATP hydrolysis and transfer electrons through a Fe4-S4 cluster to other subunit for reduction of substrate.. Length = 212 Score = 44.8 bits (106), Expect = 2e-05 Identities = 18/32 (56%), Positives = 25/32 (78%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQ 46 KGG+GK+TT+ NLS ALA +G+ VL + DP+ Sbjct: 8 KGGIGKSTTSQNLSAALAEMGKKVLQVGCDPK 39 >gnl|CDD|31539 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism]. Length = 278 Score = 44.8 bits (106), Expect = 2e-05 Identities = 17/36 (47%), Positives = 29/36 (80%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS 50 KGG+GK+TT+ NL+ ALA +G+ VL++ DP+ +++ Sbjct: 9 KGGIGKSTTSQNLAAALAELGKKVLIVGCDPKADST 44 Score = 34.4 bits (79), Expect = 0.033 Identities = 27/115 (23%), Positives = 55/115 (47%), Gaps = 7/115 (6%) Query: 146 ADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQ-QVVSD 204 AD I + E AL + + + + + +T L GII +SR+ + ++V Sbjct: 143 ADEIYIVTSGEMMALYAANNIAKGIRKYAKTGGVRL--GGII---CNSRSVDRERELVEA 197 Query: 205 VRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASELIQQER 259 + LG ++ + +PR+ + +A GK I Y ++ Y +LA ++++ E+ Sbjct: 198 FAERLGTQLIH-FVPRDNIVQKAELNGKTVIEYAPDSNQAEEYRELAKKILENEK 251 >gnl|CDD|143913 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family. Length = 269 Score = 44.7 bits (106), Expect = 3e-05 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGL 53 KGG+GK+TT+ N S ALA +G+ VL++ DP+ + ST L Sbjct: 8 KGGIGKSTTSQNTSAALAEMGKKVLIVGCDPKAD-STRL 45 >gnl|CDD|48363 cd02033, BchX, Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring. This family contains the X subunit of this three-subunit enzyme. Sequence and structure similarity between bchX, protochlorophyllide reductase L subunit (bchL and chlL) and nitrogenase Fe protein (nifH gene) suggest their functional similarity. Members of the BchX family serve as the unique electron donors to their respective catalytic subunits (bchN-bchB, bchY-bchZ and nitrogenase component 1). Mechanistically, they hydrolyze ATP and transfer electrons through a Fe4-S4 cluster.. Length = 329 Score = 43.5 bits (102), Expect = 6e-05 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Query: 4 KKSRIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGL 53 KK++II I KGG+GK+ T NLS +A G+ VLLI DP+ + ++ L Sbjct: 29 KKTQIIAIYG-KGGIGKSFTLANLSYMMAQQGKRVLLIGCDPKSDTTSLL 77 >gnl|CDD|48362 cd02032, Bchl_like, This family of proteins contains bchL and chlL. Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls. Three genes, bchL, bchN and bchB, are involved in light-independent protochlorophyllide reduction in bacteriochlorophyll biosynthesis. In cyanobacteria, algae, and gymnosperms, three similar genes, chlL, chlN and chlB are involved in protochlorophyllide reduction during chlorophylls biosynthesis. BchL/chlL, bchN/chlN and bchB/chlB exhibit significant sequence similarity to the nifH, nifD and nifK subunits of nitrogenase, respectively. Nitrogenase catalyzes the reductive formation of ammonia from dinitrogen.. Length = 267 Score = 43.0 bits (101), Expect = 9e-05 Identities = 19/32 (59%), Positives = 24/32 (75%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQ 46 KGG+GK+TT+ NLS ALA G+ VL I DP+ Sbjct: 8 KGGIGKSTTSSNLSVALAKRGKKVLQIGCDPK 39 >gnl|CDD|48369 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.. Length = 270 Score = 42.5 bits (100), Expect = 1e-04 Identities = 17/36 (47%), Positives = 28/36 (77%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS 50 KGG+GK+TT NLS ALA +G+ V+++ DP+ +++ Sbjct: 9 KGGIGKSTTTQNLSAALAEMGKKVMIVGCDPKADST 44 >gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA). This ATPase is involved in transport of arsenite, antimonite or other oxyanions across biological membranes in all three kingdoms of life. ArsA contains a highly conserved AAA motif present in the AAA+ ATPase superfamily associated with a variety of cellular activities. To form a functional ATP-driven pump, ArsA interacts with the permease ArsB, which is a channel-forming integral membrane protein. One of the most interesting features of ArsA is the allosteric activation by its transport substrates. A divalent cation, typically Mg2+, is required for its enzymatic activity.. Length = 254 Score = 41.8 bits (98), Expect = 2e-04 Identities = 44/202 (21%), Positives = 79/202 (39%), Gaps = 14/202 (6%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIE--LYDRKYSSYD-LLIEE 71 KGGVGKTT + + LA G+ VLL+ DP + S E + L E Sbjct: 8 KGGVGKTTISAATAVRLAEQGKKVLLVSTDPAHSLSDSFNQEFGKGPTPVKGVENLSAME 67 Query: 72 KNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEK-----DRLFRLDKALSVQLTSDFSY 126 + + L + L I + + L ++ IL E + + D+ +++ Sbjct: 68 IDPQEALEEYRQEVLEPIEANLLLEMLKGILEEELESPGIEEIAAFDEFSRYIDEAEYDV 127 Query: 127 IFLDCPP---SFNLLTM-NAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALD 182 + D P + LL++ ++ A IL + F L + + + ++ E R + L Sbjct: 128 VVFDTAPTGHTLRLLSLPTVLSWAREILSDPERTSFRLVCIPEKM-SLYETERAIQ-ELA 185 Query: 183 IQGIILTMFDSRNSLSQQVVSD 204 GI + L + V + Sbjct: 186 KYGIDVDAVIVNQLLPEDVTNC 207 >gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L. Length = 290 Score = 41.6 bits (98), Expect = 2e-04 Identities = 18/32 (56%), Positives = 24/32 (75%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQ 46 KGG+GK+TT+ N+S ALA G+ VL I DP+ Sbjct: 8 KGGIGKSTTSCNISIALARRGKKVLQIGCDPK 39 >gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH). CODH from Rhodospirillum rubrum catalyzes the reversible oxidation of CO to CO2. CODH contains a nickel-iron-sulfur cluster (C-center) and an iron-sulfur cluster (B-center). CO oxidation occurs at the C-center. Three accessory proteins encoded by cooCTJ genes are involved in nickel incorporation into a nickel site. CooC functions as a nickel insertase that mobilizes nickel to apoCODH using energy released from ATP hydrolysis. CooC is a homodimer and has NTPase activities. Mutation at the P-loop abolishs its function.. Length = 116 Score = 41.4 bits (97), Expect = 2e-04 Identities = 22/48 (45%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKY 62 KGGVGKTT A L+ LA G+ VL ID DP + L +E+ + K Sbjct: 7 KGGVGKTTIAALLARYLAEKGKPVLAIDADP-DDLPERLSVEVGEIKL 53 >gnl|CDD|38036 KOG2825, KOG2825, KOG2825, Putative arsenite-translocating ATPase [Inorganic ion transport and metabolism]. Length = 323 Score = 39.6 bits (92), Expect = 9e-04 Identities = 19/36 (52%), Positives = 25/36 (69%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS 50 KGGVGKTT + +L+ LA + E+VL+I DP N S Sbjct: 27 KGGVGKTTCSCSLAVQLAKVRESVLIISTDPAHNLS 62 >gnl|CDD|111283 pfam02374, ArsA_ATPase, Anion-transporting ATPase. This Pfam family represents a conserved domain, which is sometimes repeated, in an anion-transporting ATPase. The ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell. Length = 304 Score = 39.3 bits (92), Expect = 0.001 Identities = 16/36 (44%), Positives = 22/36 (61%) Query: 15 KGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS 50 KGGVGKTT + + L+ G+ VLL+ DP + S Sbjct: 9 KGGVGKTTVSCATAVRLSEQGKKVLLVSTDPAHSLS 44 >gnl|CDD|33438 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning]. Length = 255 Score = 39.0 bits (91), Expect = 0.001 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query: 15 KGGVGKTT-TAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL 57 KGGVGKTT A+ L L+ G NVL++D DP N LG+E Sbjct: 8 KGGVGKTTIAALLLKRLLSKGGYNVLVVDADPDSNLPEALGVEE 51 >gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]. Length = 284 Score = 39.1 bits (91), Expect = 0.001 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLD 44 + +A+ KGG GKTT A NL+ L ++L D D Sbjct: 2 MQVAVASGKGGTGKTTVAANLAVLL-GDKYKLVLADCD 38 Score = 29.5 bits (66), Expect = 1.0 Identities = 24/128 (18%), Positives = 46/128 (35%), Gaps = 12/128 (9%) Query: 126 YIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQG 185 + +D + ++ AD ++ + F L L + LE VE G Sbjct: 166 LLIIDSAAGTGCPVIASLKGADLAILVTEPTPFGLHDLKRALELVEHFGIPT-------G 218 Query: 186 IILTMFDSRNSLSQQVVSDVRKNLGGKVYNTVIPRNVRISEAPSYGKPAIIYDLKCAGSQ 245 I++ ++ +S ++ + G IP + I EA G+P + D K A + Sbjct: 219 IVINRYNLGDSEIEEYCEE-----EGIPILGEIPYDKDIPEAYVNGEPFVEPDSKEAEAI 273 Query: 246 AYLKLASE 253 + Sbjct: 274 LEEAEKLK 281 >gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.. Length = 173 Score = 33.2 bits (76), Expect = 0.081 Identities = 43/193 (22%), Positives = 68/193 (35%), Gaps = 67/193 (34%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS--------TGLGIELYDRKYSSYDLL 68 GVGKTTTA L+ L G+ VLL+ D A+ +G+ +++ + Sbjct: 10 GVGKTTTAAKLALYLKKKGKKVLLVAADTYRPAAIEQLRVLGEQVGVPVFEEGEGKDPVS 69 Query: 69 IE--------EKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRLFRLDKALSVQL 120 I E+N + +++ TA L I+ L E ++ R+ K Sbjct: 70 IAKRAIEHAREENFDVVIVDTA-----------GRLQIDENLMEELKKIKRVVK------ 112 Query: 121 TSDFSYIFLDCPPSFNLLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSA 180 P LL ++AM D++ + N A Sbjct: 113 ------------PDEVLLVVDAMTGQDAV----------------------NQAKAFNEA 138 Query: 181 LDIQGIILTMFDS 193 L I G+ILT D Sbjct: 139 LGITGVILTKLDG 151 >gnl|CDD|144749 pfam01268, FTHFS, Formate--tetrahydrofolate ligase. Length = 555 Score = 32.8 bits (76), Expect = 0.11 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 17 GVGKTTTAINLSTALAAIGENV 38 G GKTTT I L AL +G+ Sbjct: 68 GEGKTTTTIGLGQALNRLGKKA 89 >gnl|CDD|73210 cd00477, FTHFS, Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate. FTHFS is a highly expressed key enzyme in both the Wood-Ljungdahl pathway of autotrophic CO2 fixation (acetogenesis) and the glycine synthase/reductase pathways of purinolysis. The key physiological role of this enzyme in acetogens is to catalyze the formylation of tetrahydrofolate, an initial step in the reduction of carbon dioxide and other one-carbon precursors to acetate. In purinolytic organisms, the enzymatic reaction is reversed, liberating formate from 10-formyltetrahydrofolate with concurrent production of ATP.. Length = 524 Score = 32.0 bits (73), Expect = 0.18 Identities = 12/22 (54%), Positives = 14/22 (63%) Query: 17 GVGKTTTAINLSTALAAIGENV 38 G GKTTT I L+ AL A G+ Sbjct: 52 GEGKTTTTIGLAQALNAHGKKA 73 >gnl|CDD|36570 KOG1356, KOG1356, KOG1356, Putative transcription factor 5qNCA, contains JmjC domain [Transcription]. Length = 889 Score = 31.1 bits (70), Expect = 0.32 Identities = 17/87 (19%), Positives = 35/87 (40%), Gaps = 6/87 (6%) Query: 25 INLSTALAAIGENVLLIDLDPQGNASTGLGIELYDRKYSSYDLLIEEKNINQILIQTAIP 84 +NL++ L E + DL P+ + G+ E R + +L ++ + IL+ P Sbjct: 649 LNLASKLP---EGFVRPDLGPKLYNAYGVSTE-LGRGDGTTNLHLDVSDAVNILVYVGEP 704 Query: 85 NLSI--IPSTMDLLGIEMILGGEKDRL 109 I I + + + + R+ Sbjct: 705 PGQIEQIAKVLKKIQEGDLDEITRSRI 731 >gnl|CDD|40027 KOG4830, KOG4830, KOG4830, Predicted sugar transporter [Carbohydrate transport and metabolism]. Length = 412 Score = 28.9 bits (64), Expect = 1.4 Identities = 14/67 (20%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Query: 50 STGLGIELYDRKYSSYDLLIEEKNINQILIQTAIPNLSIIPSTMDLLGIEMILGGEKDRL 109 S G+ +L + +YD L + I + +P ++ + + LL + GE+ R Sbjct: 343 SNGIAYQLIELWTPAYDAL--KSAIFYRRVMVFVPGTCLVLAFLVLLSLAPFKIGERRRA 400 Query: 110 FRLDKAL 116 D+ Sbjct: 401 RPEDEQA 407 >gnl|CDD|133370 cd04170, EF-G_bact, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains only bacterial members. Length = 268 Score = 28.7 bits (65), Expect = 1.6 Identities = 9/26 (34%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Query: 128 FLDCPPSFNLL--TMNAMAAADSILV 151 +D P + + T A+ AAD+ LV Sbjct: 68 LIDTPGYADFVGETRAALRAADAALV 93 >gnl|CDD|114472 pfam05748, Rubella_E1, Rubella membrane glycoprotein E1. Rubella virus (RV), the sole member of the genus Rubivirus within the family Togaviridae, is a small enveloped, positive strand RNA virus. The nucleocapsid consists of 40S genomic RNA and a single species of capsid protein which is enveloped within a host-derived lipid bilayer containing two viral glycoproteins, E1 (58 kDa) and E2 (42-46 kDa). In virus infected cells, RV matures by budding either at the plasma membrane, or at the internal membranes depending on the cell type and enters adjacent uninfected cells by a membrane fusion process in the endosome, directed by E1-E2 heterodimers. The heterodimer formation is crucial for E1 transport out of the endoplasmic reticulum to the Golgi and plasma membrane. In RV E1, a cysteine at position 82 is crucial for the E1-E2 heterodimer formation and cell surface expression of the two proteins. The E1 has been shown to be a type 1 membrane protein, rich in cysteine residues with extensive intramolecular disulfide bonds. Length = 496 Score = 28.6 bits (63), Expect = 1.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 219 PRNVRISEAPSYGKPAIIYDLKCAGSQAYLKLASE 253 PRNVR++ G PA++ L G +L + E Sbjct: 356 PRNVRVTGCYQCGTPALVEGLAPGGGNCHLTVNGE 390 >gnl|CDD|31982 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism]. Length = 451 Score = 28.2 bits (63), Expect = 2.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Query: 9 ITIANQKGGVGKTTTAINLSTALAAIGENV 38 + IA G GKTT + L AL G V Sbjct: 3 VVIAGTSSGSGKTTVTLGLMRALRRRGLKV 32 >gnl|CDD|48077 cd01976, Nitrogenase_MoFe_alpha, Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit. A group of proteins similar to the alpha subunit of the MoFe protein of the molybdenum (Mo-) nitrogenase. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Mo-nitrogenase is the most widespread and best characterized of these systems. Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2). MoFe is an alpha2beta2 tetramer. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster. Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.. Length = 421 Score = 28.3 bits (63), Expect = 2.2 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 25/107 (23%) Query: 75 NQILIQTAIPNLSIIPSTMDLLGIEMILGGEK---------DRLFRLDKALSVQLTSDFS 125 N +T + N + T D +++ GG+K LF L+K +SVQ Sbjct: 53 NYYRGETGVDNFGTMQFTTDFQEKDIVFGGDKKLAKAIDEAYELFPLNKGISVQSE---- 108 Query: 126 YIFLDCPPSFNLLTMNAMAAADS-----ILVPLQCEFFALEGLSQLL 167 CP + A+A S +VP++CE F G+SQ L Sbjct: 109 -----CPVGLIGDDIEAVARKASKELGIPVVPVRCEGF--RGVSQSL 148 >gnl|CDD|32626 COG2759, MIS1, Formyltetrahydrofolate synthetase [Nucleotide transport and metabolism]. Length = 554 Score = 28.3 bits (63), Expect = 2.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 17 GVGKTTTAINLSTALAAIGENVLL 40 G GKTTT I L AL +G+ ++ Sbjct: 66 GEGKTTTTIGLVDALNKLGKKAII 89 >gnl|CDD|173856 cd08491, PBP2_NikA_DppA_OppA_like_12, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction. Length = 473 Score = 28.1 bits (63), Expect = 2.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 173 VRRTVNSALDIQGIILTMFDSRNSLSQQVV 202 VR+ +N A+D GI+ +F + + Q+V Sbjct: 249 VRKALNLAIDRDGIVGALFGGQGRPATQLV 278 >gnl|CDD|36746 KOG1533, KOG1533, KOG1533, Predicted GTPase [General function prediction only]. Length = 290 Score = 27.9 bits (62), Expect = 3.2 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLDP 45 G GK+T +S L+AIG V +++LDP Sbjct: 12 GSGKSTYCNGMSQFLSAIGRPVAVVNLDP 40 >gnl|CDD|48378 cd03114, ArgK-like, The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.. Length = 148 Score = 27.5 bits (61), Expect = 4.1 Identities = 15/37 (40%), Positives = 20/37 (54%) Query: 16 GGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTG 52 G GK+T L TAL A G+ V ++ +DP S G Sbjct: 8 PGAGKSTLIDALITALRARGKRVAVLAIDPSSPFSGG 44 >gnl|CDD|30004 cd01394, radB, RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.. Length = 218 Score = 27.2 bits (60), Expect = 5.0 Identities = 13/36 (36%), Positives = 16/36 (44%) Query: 7 RIITIANQKGGVGKTTTAINLSTALAAIGENVLLID 42 +T G GKT AI L+ A G+ V ID Sbjct: 19 GTVTQVYGPPGTGKTNIAIQLAVETAGQGKKVAYID 54 >gnl|CDD|30887 COG0541, Ffh, Signal recognition particle GTPase [Intracellular trafficking and secretion]. Length = 451 Score = 27.0 bits (60), Expect = 5.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLDPQ 46 G GKTTTA L+ L G+ VLL+ D Sbjct: 110 GSGKTTTAGKLAKYLKKKGKKVLLVAADTY 139 >gnl|CDD|33690 COG3903, COG3903, Predicted ATPase [General function prediction only]. Length = 414 Score = 26.8 bits (59), Expect = 6.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 16 GGVGKTTTAINLSTALAAIGENVLLIDLDPQGNAS 50 GGVGKTT A+ + A + + V +DL P + + Sbjct: 23 GGVGKTTLALQAAHAASEYADGVAFVDLAPITDPA 57 >gnl|CDD|147155 pfam04851, ResIII, Type III restriction enzyme, res subunit. Length = 103 Score = 26.8 bits (60), Expect = 7.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Query: 17 GVGKTTTAINLSTALAAIGENVLLI----DLDPQ 46 G GKT TA L L + VL + DL Q Sbjct: 28 GSGKTLTAAKLIARLLKGKKKVLFLVPRKDLLEQ 61 >gnl|CDD|144151 pfam00448, SRP54, SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins. Length = 196 Score = 26.7 bits (60), Expect = 7.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLD 44 G GKTTT L+ L G+ VLL+ D Sbjct: 11 GSGKTTTIAKLAAYLKKQGKKVLLVAAD 38 >gnl|CDD|37016 KOG1805, KOG1805, KOG1805, DNA replication helicase [Replication, recombination and repair]. Length = 1100 Score = 26.5 bits (58), Expect = 7.5 Identities = 13/25 (52%), Positives = 15/25 (60%) Query: 17 GVGKTTTAINLSTALAAIGENVLLI 41 G GKTTT L L A+G+ VLL Sbjct: 695 GTGKTTTISLLIKILVALGKKVLLT 719 >gnl|CDD|30875 COG0529, CysC, Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]. Length = 197 Score = 26.4 bits (58), Expect = 7.6 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL 57 G GK+T A L L A G +V L+D D N GL +L Sbjct: 33 GSGKSTIANALEEKLFAKGYHVYLLDGD---NVRHGLNRDL 70 >gnl|CDD|29990 cd01124, KaiC, KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.. Length = 187 Score = 26.4 bits (58), Expect = 7.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Query: 17 GVGKTTTAINLSTALAAIGENVLLIDLD 44 G GKTT A+ A A GE L + L+ Sbjct: 9 GTGKTTFALQFLYAGLARGEPGLYVTLE 36 >gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]. Length = 387 Score = 26.2 bits (57), Expect = 8.7 Identities = 13/42 (30%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Query: 16 GGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGLGIEL 57 G A+ ALA G +V L++ P+ G GI L Sbjct: 10 AGPAGLALAL----ALARAGLDVTLLERAPRELLERGRGIAL 47 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.135 0.365 Gapped Lambda K H 0.267 0.0509 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,905,529 Number of extensions: 148420 Number of successful extensions: 454 Number of sequences better than 10.0: 1 Number of HSP's gapped: 435 Number of HSP's successfully gapped: 86 Length of query: 265 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 173 Effective length of database: 4,275,709 Effective search space: 739697657 Effective search space used: 739697657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (25.9 bits)