>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548 Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2. It binds to guanine nucleotides and has a strong preference for UGA stop codons. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis sp. (strain PCC 6803), and in Staphylococcus aureus.; GO: 0005525 GTP binding, 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.

Probab=97.24 E-value=0.00054 Score=47.49 Aligned_cols=105 Identities=21% Similarity=0.314 Sum_probs=75.4 Q ss_pred CEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCC----------EEECC----------C---CCCCCCEEEEEEECCHH Q ss_conf 0243114663188899998552000234546872----------11000----------1---24568358999508100 Q gi|254780809|r 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTT----------RDVLT----------I---DLDLEGYLVKISDTAGI 277 (440) Q Consensus 221 ~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTT----------RD~i~----------~---~~~i~g~~~~l~DTaGi 277 (440) T Consensus 13 ~FAIISHPDAGKTT~TEK~LLyG~AI--Q~AG~VK~r~S~~~A~SDWM~ME~QRGISIT~~VlQF~Y~~~l~NLLDTPGH 90 (530) T TIGR00503 13 TFAIISHPDAGKTTLTEKVLLYGGAI--QTAGAVKGRGSQRHAKSDWMEMEKQRGISITTSVLQFPYRDCLVNLLDTPGH 90 (530) T ss_pred CEEEEECCCCCCHHHHHHHHHHHHHH--HHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECCCCCEEECCCCCCC T ss_conf 54366168887424678888742566--5224412200122122137887505881444127741457745620368588 Q ss_pred CC-CCHHHHHHHHHHHHHHHHHHCCEEECCCCCCH--------HHHHHHCCCCCCCCCCCCCCCCCCC Q ss_conf 02-41035666678889985030110201358985--------6634312898532222333446542 Q gi|254780809|r 278 RE-TDDIVEKEGIKRTFLEVENADLILLLKEINSK--------KEISFPKNIDFIFIGTKSDLYSTYT 336 (440) Q Consensus 278 r~-t~d~IE~~GI~ra~~~i~~aDlil~v~D~~~~--------~~~~~~~~~~~i~V~NK~Dl~~~~~ 336 (440) T Consensus 91 ~DFSED---------TYRTL~A~D~~~M~IDaAKG~E~~T~KL~EV~RLR~~PI~TF~NKLDR~~~~P 149 (530) T TIGR00503 91 EDFSED---------TYRTLTAVDNCLMVIDAAKGVETRTRKLMEVTRLRDLPILTFINKLDRDIRDP 149 (530) T ss_pred CCCCCH---------HHHHHHHHHHHEEEHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCH T ss_conf 876404---------67999985123001111256123424454201000474433523206543553

HHsearch alignment for GI: 254780809 and conserved domain: TIGR00503