HHsearch alignment for GI: 254780809 and conserved domain: cd01886

>cd01886 EF-G Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group conta
Probab=98.78  E-value=2.5e-08  Score=77.62  Aligned_cols=105  Identities=18%  Similarity=0.069  Sum_probs=71.2

Q ss_pred             CEEEECCCCCCHHHHHHHHHCCHHCCCCCCC-----CCC-EEEC-------------CCCCCCCCEEEEEEECCHHCCCC
Q ss_conf             0243114663188899998552000234546-----872-1100-------------01245683589995081000241
Q gi|254780809|r  221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIP-----GTT-RDVL-------------TIDLDLEGYLVKISDTAGIRETD  281 (440)
Q Consensus       221 ~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~-----GTT-RD~i-------------~~~~~i~g~~~~l~DTaGir~t~  281 (440)
T Consensus         1 Niai~gH~gaGKTtL~EalL~~ag~i--~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~DF~   78 (270)
T cd01886           1 NIGIIAHIDAGKTTTTERILYYTGRI--HKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVDFT   78 (270)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCC--CCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHHHH
T ss_conf             98999689999889999999866873--5581553897556684889876870733668999899899998696967889


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEECCCCCCHHH------H--HHHCCCCCCCCCCCCCCCCCC
Q ss_conf             03566667888998503011020135898566------3--431289853222233344654
Q gi|254780809|r  282 DIVEKEGIKRTFLEVENADLILLLKEINSKKE------I--SFPKNIDFIFIGTKSDLYSTY  335 (440)
Q Consensus       282 d~IE~~GI~ra~~~i~~aDlil~v~D~~~~~~------~--~~~~~~~~i~V~NK~Dl~~~~  335 (440)
T Consensus        79 ~e--------~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~i~fINKmDre~ad  132 (270)
T cd01886          79 IE--------VERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFVNKMDRTGAD  132 (270)
T ss_pred             HH--------HHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC
T ss_conf             99--------9999877555999984676442636999988998499989999887877887