>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

Probab=99.43 E-value=6.8e-13 Score=109.26 Aligned_cols=132 Identities=17% Similarity=0.212 Sum_probs=96.7 Q ss_pred CEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCCEEECCCCCCCCCEEEEEEECCHHCCCCHHHHHHHHHHHHHHHHHHC Q ss_conf 02431146631888999985520002345468721100012456835899950810002410356666788899850301 Q gi|254780809|r 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENAD 300 (440) Q Consensus 221 ~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTTRD~i~~~~~i~g~~~~l~DTaGir~t~d~IE~~GI~ra~~~i~~aD 300 (440) T Consensus 1 KIlilGl~~sGKTtil~~l~~~~~~~~~pT~G----~~~~~i~~~~~~l~iwD~gG~~~~r--------~~w~~Yy~~~~ 68 (169) T cd04158 1 RVVTLGLDGAGKTTILFKLKQDEFMQPIPTIG----FNVETVEYKNLKFTIWDVGGKHKLR--------PLWKHYYLNTQ 68 (169) T ss_pred CEEEECCCCCCHHHHHHHHHCCCCCCCCCCCC----CCEEEEEECCEEEEEEECCCCCCCC--------HHHHHHCCCCC T ss_conf 99999989998899999995799689778688----1669999898899999899972446--------36787555762 Q ss_pred CEEECCCCCCHHHHH-------------HHCCCCCCCCCCCCCCCCCCCHH-----------------HHHHHHHHHHHH Q ss_conf 102013589856634-------------31289853222233344654200-----------------000133332323 Q gi|254780809|r 301 LILLLKEINSKKEIS-------------FPKNIDFIFIGTKSDLYSTYTEE-----------------YDHLISSFTGEG 350 (440) Q Consensus 301 lil~v~D~~~~~~~~-------------~~~~~~~i~V~NK~Dl~~~~~~~-----------------~~~~ISaktg~G 350 (440) T Consensus 69 ~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK~Dl~~~~~~~ei~~~l~l~~~~~~~~~~i~~~SA~tG~G 148 (169) T cd04158 69 AVVFVVDSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEMTELLSLHKLCCGRSWYIQGCDARSGMG 148 (169) T ss_pred EEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCCHHHCCCCCEEEEEEECCCCCC T ss_conf 79999986306779999999999971275379849999735567779899999998570545269962999555727959 Q ss_pred HHHHHHHHHHHHHH Q ss_conf 58999999999632 Q gi|254780809|r 351 LEELINKIKSILSN 364 (440) Q Consensus 351 i~~L~~~I~~~l~~ 364 (440) T Consensus 149 i~e~~~WL~~~ii~ 162 (169) T cd04158 149 LYEGLDWLSRQLVA 162 (169) T ss_pred HHHHHHHHHHHHHH T ss_conf 89999999999986

HHsearch alignment for GI: 254780809 and conserved domain: cd04158