>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=98.78 E-value=2.4e-08 Score=77.73 Aligned_cols=105 Identities=30% Similarity=0.308 Sum_probs=73.1 Q ss_pred CEEEECCCCCCHHHHHHHHHCCHHCCCCCCCC-----CC-EEECC-------------CCCCCCCEEEEEEECCHHCCCC Q ss_conf 02431146631888999985520002345468-----72-11000-------------1245683589995081000241 Q gi|254780809|r 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPG-----TT-RDVLT-------------IDLDLEGYLVKISDTAGIRETD 281 (440) Q Consensus 221 ~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~G-----TT-RD~i~-------------~~~~i~g~~~~l~DTaGir~t~ 281 (440) T Consensus 1 Ni~iigH~~aGKTtL~E~lL~~~g~i--~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w~~~~inliDTPG~~DF~ 78 (268) T cd04170 1 NIALVGHSGSGKTTLAEALLYATGAI--DRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEWKGHKINLIDTPGYADFV 78 (268) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCC--CCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEECCEEEEEEECCCCHHHH T ss_conf 98999089999899999999966996--6576545897357787889867967513557888899799998698975799 Q ss_pred HHHHHHHHHHHHHHHHHHCCEEECCCCCCHHHH--------HHHCCCCCCCCCCCCCCCCCC Q ss_conf 035666678889985030110201358985663--------431289853222233344654 Q gi|254780809|r 282 DIVEKEGIKRTFLEVENADLILLLKEINSKKEI--------SFPKNIDFIFIGTKSDLYSTY 335 (440) Q Consensus 282 d~IE~~GI~ra~~~i~~aDlil~v~D~~~~~~~--------~~~~~~~~i~V~NK~Dl~~~~ 335 (440) T Consensus 79 ~--------e~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~~ad 132 (268) T cd04170 79 G--------ETRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRERAD 132 (268) T ss_pred H--------HHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC T ss_conf 9--------99998404783999941875476879999999998599989999787878996

HHsearch alignment for GI: 254780809 and conserved domain: cd04170