HHsearch alignment for GI: 254780810 and conserved domain: COG0466

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones].
Probab=95.30  E-value=0.025  Score=34.46  Aligned_cols=123  Identities=19%  Similarity=0.226  Sum_probs=68.6

Q ss_pred             CCHHHHHCCCCHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             88788512443000200011223432477865321368889988655102312220487787899999999998611886
Q gi|254780810|r  125 DVPERVRNKIHFDNLTPLYPDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPE  204 (423)
Q Consensus       125 ~~~d~~~~~~~f~~l~p~~p~~~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~  204 (423)
T Consensus       312 ~Dl~~a~~iLd~dHYGLekVKeRIlEy--------L---AV~~l~~~~kGpILcLVGPPGVGKTSLgkSIA~al~Rk---  377 (782)
T COG0466         312 LDLKKAEKILDKDHYGLEKVKERILEY--------L---AVQKLTKKLKGPILCLVGPPGVGKTSLGKSIAKALGRK---  377 (782)
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHHH--------H---HHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCC---
T ss_conf             229999987443556711689999999--------9---99986146788579997899887011899999995897---


Q ss_pred             CEEEEEECCCCHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHH
Q ss_conf             46999950878789999998403427823667888899999999999999999779928999816389877620
Q gi|254780810|r  205 CYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEMVIAKAKCLVEYGLDVVILLDSITRLCRAYN  278 (423)
Q Consensus       205 v~~i~~ligEr~~ev~e~~~~~~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~e~G~dVll~~DslTR~ArA~~  278 (423)
T Consensus       378 -fvR~sLGGvrDE--AEIRGHRRTYIGa-----MPGrIiQ~----mkk-----a~~~NPv~LLDEIDKm~ss~r  434 (782)
T COG0466         378 -FVRISLGGVRDE--AEIRGHRRTYIGA-----MPGKIIQG----MKK-----AGVKNPVFLLDEIDKMGSSFR  434 (782)
T ss_pred             -EEEEECCCCCCH--HHHCCCCCCCCCC-----CCHHHHHH----HHH-----HCCCCCEEEEECHHHCCCCCC
T ss_conf             -799954765427--7753553123356-----87289999----998-----677687478640333167777