HHsearch alignment for GI: 254780810 and conserved domain: COG0541

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion].
Probab=92.27  E-value=0.86  Score=24.34  Aligned_cols=91  Identities=30%  Similarity=0.394  Sum_probs=55.5

Q ss_pred             CCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHH---HHHHCCEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             312220487787899999999998611886469999508787899999---98403427823667888899999999999
Q gi|254780810|r  175 QRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDM---QRSVQGEVISSTFDESAARHVQVAEMVIA  251 (423)
Q Consensus       175 qr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~---~~~~~~~vv~st~d~~~~~~~~~a~~a~~  251 (423)
T Consensus       101 ~vImmvGLQGsGKTTt~~KLA~~lkk~~~kv-llVaaD~~RpAA~eQL~~La~q~~v~~f~~~~~~~Pv~---Iak~al~  176 (451)
T COG0541         101 TVILMVGLQGSGKTTTAGKLAKYLKKKGKKV-LLVAADTYRPAAIEQLKQLAEQVGVPFFGSGTEKDPVE---IAKAALE  176 (451)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHCCCCE-EEEECCCCCHHHHHHHHHHHHHCCCCEECCCCCCCHHH---HHHHHHH
T ss_conf             5899981567974868999999999749945-89850567868999999999860985316778899799---9999999


Q ss_pred             HHHHHHHCCCCEEEEEECHHHH
Q ss_conf             9999997799289998163898
Q gi|254780810|r  252 KAKCLVEYGLDVVILLDSITRL  273 (423)
Q Consensus       252 ~a~~~~e~G~dVll~~DslTR~  273 (423)
T Consensus       177 ~ak---~~~~DvvI-vDTAGRl  194 (451)
T COG0541         177 KAK---EEGYDVVI-VDTAGRL  194 (451)
T ss_pred             HHH---HCCCCEEE-EECCCCC
T ss_conf             999---74998899-9688733