HHsearch alignment for GI: 254780810 and conserved domain: COG0552

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion].
Probab=96.59  E-value=0.023  Score=34.63  Aligned_cols=126  Identities=28%  Similarity=0.300  Sum_probs=79.3

Q ss_pred             CCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCC-CHHH---HHHHHHHHCCEEEE-CCCCCCHHHHHHHHHH
Q ss_conf             23122204877878999999999986118864699995087-8789---99999840342782-3667888899999999
Q gi|254780810|r  174 GQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDE-RPEE---VTDMQRSVQGEVIS-STFDESAARHVQVAEM  248 (423)
Q Consensus       174 gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligE-r~~e---v~e~~~~~~~~vv~-st~d~~~~~~~~~a~~  248 (423)
T Consensus       139 p~Vil~vGVNG~GKTTTIaKLA~~l~~~g~~Vll--aA~DTFRAaAiEQL~~w~er~gv~vI~~~~G~DpAa----VafD  212 (340)
T COG0552         139 PFVILFVGVNGVGKTTTIAKLAKYLKQQGKSVLL--AAGDTFRAAAIEQLEVWGERLGVPVISGKEGADPAA----VAFD  212 (340)
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEE--EECCHHHHHHHHHHHHHHHHHCCEEECCCCCCCCHH----HHHH
T ss_conf             6799999348886371799999999978986999--823347899999999999995992782599998089----9999


Q ss_pred             HHHHHHHHHHCCCCEEEE------------EECHHHHHHHHHCCCC-CCCCCC-C--CCCCHHHHHHCHHHHHCCC
Q ss_conf             999999999779928999------------8163898776200136-677767-7--7520246650468752257
Q gi|254780810|r  249 VIAKAKCLVEYGLDVVIL------------LDSITRLCRAYNVLMP-SSGKIL-T--GGVDANALQRPKRFFGAAR  308 (423)
Q Consensus       249 a~~~a~~~~e~G~dVll~------------~DslTR~ArA~~~~~~-~~g~~~-~--gg~~~~~l~~~~~~~~~ar  308 (423)
T Consensus       213 Ai~~Ak---ar~~DvvliDTAGRLhnk~nLM~EL~KI~rV~~k~~~~ap~e~llvlDAttGqnal~QAk~F~eav~  285 (340)
T COG0552         213 AIQAAK---ARGIDVVLIDTAGRLHNKKNLMDELKKIVRVIKKDDPDAPHEILLVLDATTGQNALSQAKIFNEAVG  285 (340)
T ss_pred             HHHHHH---HCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             999999---7699999996755445736689999999998464568998428999775647568999999987528