HHsearch alignment for GI: 254780810 and conserved domain: COG1066

>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones].
Probab=96.90  E-value=0.0033  Score=40.23  Aligned_cols=56  Identities=21%  Similarity=0.275  Sum_probs=41.9

Q ss_pred             CCCHHHHHHHHHHH--HHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCH
Q ss_conf             32136888998865--5102312220487787899999999998611886469999508787
Q gi|254780810|r  157 NKDISSRVIDLIAP--IGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERP  216 (423)
Q Consensus       157 p~~~~~~~id~~~p--ig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~  216 (423)
T Consensus        74 Ri~tg~~EldRVLGGG~V~Gs~iLIgGdPGIGKSTLLLQva~~lA~~~---~vLYV-sGEES  131 (456)
T COG1066          74 RISTGIEELDRVLGGGLVPGSVILIGGDPGIGKSTLLLQVAARLAKRG---KVLYV-SGEES  131 (456)
T ss_pred             CCCCCHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCC---CEEEE-ECCCC
T ss_conf             235781888765367723661799736898779899999999987059---57999-67767