HHsearch alignment for GI: 254780810 and conserved domain: COG1156

>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion].
Probab=100.00  E-value=1.9e-38  Score=272.18  Aligned_cols=336  Identities=16%  Similarity=0.101  Sum_probs=280.2

Q ss_pred             CEEEEECCCCCCCCCCCCEEECCCCCCCCCCCCCE-EEEEEEECCCCCCCCCCEEECCCCCCCHHHHHCCCCHHHCCCCC
Q ss_conf             02675045486666556046010000122125987-99988624688876300022225568878851244300020001
Q gi|254780810|r   65 FGFLRSPDANYLAGPDDIYVSPSQIKSFSLKTGDT-VEGSIRAPREGERYFALLKVNAINFDVPERVRNKIHFDNLTPLY  143 (423)
Q Consensus        65 yGFLR~~~~~yl~~~~DiyVs~slir~f~Lr~GD~-V~g~~r~~~~~~~~~~L~rV~~vnG~~~d~~~~~~~f~~l~p~~  143 (423)
T Consensus        38 ~G~~r~--gqVle~~~~~a~vQVfegT~Gl~~~~t~vrF~g~~l~i~vs~dllGRifnG~G~PiDggp~i~~e~~~dI~g  115 (463)
T COG1156          38 DGEVRR--GQVLEVRGDKAVVQVFEGTSGLDTKGTTVRFTGETLKIPVSEDLLGRIFNGSGKPIDGGPEIVPEDRLDING  115 (463)
T ss_pred             CCCEEE--EEEEECCCCEEEEEEEECCCCCCCCCCEEEEECCEEEEEECHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             987643--457531586489999504457788885589948637876328766544057888478998678775533578


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCC-CC-EEEEEECCCCHHHHHH
Q ss_conf             122343247786532136888998865510231222048778789999999999861188-64-6999950878789999
Q gi|254780810|r  144 PDKRFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHP-EC-YLIVLLIDERPEEVTD  221 (423)
Q Consensus       144 p~~~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~-~v-~~i~~ligEr~~ev~e  221 (423)
T Consensus       116 ~~~NP~aR~yP~efIqTgIsaIDg~NtLvrgQKlPIFSgSGlphN~LaaqIarQA~v~~~~e~favVfaamGit~eea~f  195 (463)
T COG1156         116 APINPYARIYPEEFIQTGISAIDGMNTLVRGQKLPIFSGSGLPHNELAAQIARQATVDGEEEEFAVVFAAMGITHEEALF  195 (463)
T ss_pred             CCCCCHHHHCHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCHHHHHH
T ss_conf             87891565472667652960876434653365466012799843799999997536678754305887404731899999


Q ss_pred             HHHHH-------CCEEEECCCCCCHHHHHHHHHHHHHHHHHHH-HCCCCEEEEEECHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             99840-------3427823667888899999999999999999-779928999816389877620013667776777520
Q gi|254780810|r  222 MQRSV-------QGEVISSTFDESAARHVQVAEMVIAKAKCLV-EYGLDVVILLDSITRLCRAYNVLMPSSGKILTGGVD  293 (423)
Q Consensus       222 ~~~~~-------~~~vv~st~d~~~~~~~~~a~~a~~~a~~~~-e~G~dVll~~DslTR~ArA~~~~~~~~g~~~~gg~~  293 (423)
T Consensus       196 F~~~fe~tGal~r~vlflnlA~dp~vEri~tPr~aLt~AEylA~e~~~hVLVilTDMTnyceALREIsaareeVPgrRGY  275 (463)
T COG1156         196 FMDEFEETGALDRAVLFLNLADDPAVERIITPRMALTVAEYLAFEKDMHVLVILTDMTNYCEALREISAAREEVPGRRGY  275 (463)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             99888762246666765423678743476131689999999852578669999701467899999987641437776788


Q ss_pred             HHHHHH-CHHHHHCCCCCCC-CCCCEEEEEEEECCCCCCCCHHHHHHHHCCCCEEEEEHHHHHCCCCCCCCCCCCCCCCH
Q ss_conf             246650-4687522577777-78500121120126765541388988522660789808788479997405335422101
Q gi|254780810|r  294 ANALQR-PKRFFGAARNIKE-GGSLTIIGTALVDTGSRMDEVIFEEFKGTGNSEIVLERKIADKRIFPAMDIIKSGTRKE  371 (423)
Q Consensus       294 ~~~l~~-~~~~~~~ar~~~~-~Gs~T~~~t~lvetg~~~d~~i~~~~~~~~d~~i~L~r~la~~~~~PAId~~~S~sR~~  371 (423)
T Consensus       276 PGymYTdLatiYErAg~i~g~~GSiTqipIlTMP-~DDITHPIPDlTGYITEGQivl~r~l~~~gIyPpi~vlpSLSRL~  354 (463)
T COG1156         276 PGYMYTDLATIYERAGRIRGRKGSITQIPILTMP-GDDITHPIPDLTGYITEGQIVLSRDLHRKGIYPPINVLPSLSRLM  354 (463)
T ss_pred             CCHHHHHHHHHHHHHCEECCCCCCEEEEEEEECC-CCCCCCCCCCCCCEECCCEEEEEHHCCCCCCCCCCCCCCCHHHHH
T ss_conf             6166778899987650330578726987765269-987678777655533165599971002488679723361277776


Q ss_pred             HHCCC-----HHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             55199-----999999999999961269378999999
Q gi|254780810|r  372 DLLVE-----RQDLQKVFMLRRIVSSMNSSDAIEFLI  403 (423)
Q Consensus       372 ~~l~~-----~~~~~~~~~~r~~l~~~~~~e