HHsearch alignment for GI: 254780810 and conserved domain: COG4555

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism].
Probab=93.74  E-value=0.06  Score=31.93  Aligned_cols=57  Identities=19%  Similarity=0.149  Sum_probs=37.6

Q ss_pred             HHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHH
Q ss_conf             998865510231222048778789999999999861188646999950878789999
Q gi|254780810|r  165 IDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTD  221 (423)
Q Consensus       165 id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e  221 (423)
T Consensus        19 rdVSF~ae~Gei~GlLG~NGAGKTT~LRmiatlL~P~~G~v~idg~d~~~~p~~vrr   75 (245)
T COG4555          19 RDVSFEAEEGEITGLLGENGAGKTTLLRMIATLLIPDSGKVTIDGVDTVRDPSFVRR   75 (245)
T ss_pred             HHEEEEECCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHH
T ss_conf             652578506649998768988712379999983258886499840021017187752