HHsearch alignment for GI: 254780810 and conserved domain: COG4586

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only].
Probab=93.36  E-value=0.034  Score=33.60  Aligned_cols=34  Identities=24%  Similarity=0.265  Sum_probs=30.3

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             8899886551023122204877878999999999
Q gi|254780810|r  163 RVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAH  196 (423)
Q Consensus       163 ~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~  196 (423)
T Consensus        39 AVqdisf~IP~G~ivgflGaNGAGKSTtLKmLTG   72 (325)
T COG4586          39 AVQDISFEIPKGEIVGFLGANGAGKSTTLKMLTG   72 (325)
T ss_pred             HHHEEEEECCCCCEEEEECCCCCCCHHHHHHHHC
T ss_conf             6551145348986898875888860333989738