HHsearch alignment for GI: 254780810 and conserved domain: COG4619

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only].
Probab=94.51  E-value=0.03  Score=33.94  Aligned_cols=62  Identities=24%  Similarity=0.310  Sum_probs=38.9

Q ss_pred             HHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             65510231222048778789999999999861188646999950878789999998403427823667888899999999
Q gi|254780810|r  169 APIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVLLIDERPEEVTDMQRSVQGEVISSTFDESAARHVQVAEM  248 (423)
Q Consensus       169 ~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~ligEr~~ev~e~~~~~~~~vv~st~d~~~~~~~~~a~~  248 (423)
T Consensus        24 l~v~~Ge~iaitGPSG~GKStllk~va~Lis---p~~G~l~-f---~Ge~vs~--------------~~pea~Rq~VsY~   82 (223)
T COG4619          24 LSVRAGEFIAITGPSGCGKSTLLKIVASLIS---PTSGTLL-F---EGEDVST--------------LKPEAYRQQVSYC   82 (223)
T ss_pred             EEECCCCEEEEECCCCCCHHHHHHHHHHCCC---CCCCEEE-E---CCCCCCC--------------CCHHHHHHHHHHH
T ss_conf             6653885488767887668899999981369---9885288-7---4733443--------------4859999999999


Q ss_pred             HHH
Q ss_conf             999
Q gi|254780810|r  249 VIA  251 (423)
Q Consensus       249 a~~  251 (423)
T Consensus        83 ~Q~   85 (223)
T COG4619          83 AQT   85 (223)
T ss_pred             HCC
T ss_conf             728